KEGG   Erwinia amylovora ATCC 49946: EAM_0380
Entry
EAM_0380          CDS       T01199                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11910  type VI secretion system protein VasJ
Organism
eay  Erwinia amylovora ATCC 49946
Brite
KEGG Orthology (KO) [BR:eay00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eay02044]
    EAM_0380
Secretion system [BR:eay02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EAM_0380
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N
Other DBs
NCBI-ProteinID: CBJ45055
Position
463556..465163
AA seq 535 aa
MSSPEALLSACTTDKKEQQHLLSRASEALSLWDNWLRPLGPEQGAGDDPAYDDNFQLMRE
EINKLSGTDAQLLCELAEKCLCESAKDIRVVTWYIQARLSREGEKGLAEGLLLLAAMLSH
YGKRCHPQRPNARKAALEWLNSGKVLDALSLWPEADRNDAGLTAGAVTLLASAIADWPDS
EKPSFAGLCIALENRLARSGGMEALIPQNSGAREVGRAFVLSDSPLLSAVKSGRDLLDQA
RLLARWLGEQPQGWLASHRLMKTVRWDTVDQVPPLDNSGRTRLVPPKAEYRAQLKRFYLQ
KNWTELVEQASQMFCEGVNHFWLDLQWYLWQGLSHGGQPWETWADSVLLDLRLFLQRLPG
LDLLAWSDGTPFADEVTQGWIAGKVNEDERVFHDDAATVANSQADDVLSLEAEAMEKGDS
ESPEAAIAWLQIRPGAETPRQRWLMRLLMARVAEQYGRNDMALHLLGELTASAPRLTLVD
WEPALLFEVQARRLKLLRMKAGRSAAEKALMMPEMDTLLAGLIAIDPARAMVLCG
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgagttcgccagaagcgttgttatcagcctgcaccacagacaagaaagagcagcagcat
cttctctcgcgggcatctgaagccctgtcactttgggataactggttacgtcctctcggc
ccggaacagggagccggagacgatccggcctatgatgataacttccaactgatgcgcgaa
gaaatcaacaaactttccggtaccgatgcgcaactgctgtgtgagctggcggaaaaatgc
ctgtgcgagagcgccaaagatatccgggtagtgacctggtacattcaggcccgtctgagc
cgtgagggcgagaaagggctggcggagggcttattgctgttggctgccatgctgtcccat
tacggaaaacggtgccatccacagcgccccaacgcccgcaaggctgcgctggagtggctg
aacagtggcaaagtgctcgacgcactgtcgctatggccggaggcggaccgcaacgacgcg
ggcctgactgccggagccgttactctgcttgcttccgctattgctgactggccggatagc
gaaaaaccatcctttgcaggactctgtatcgcactggaaaatcgcctggcacgttcagga
ggcatggaggcattgattccccaaaacagtggtgcccgggaagtgggtcgcgcattcgtc
ctttccgattcaccactgttgtctgccgtgaagtccggtcgcgacttgcttgaccaggcc
aggttgcttgcccgctggctgggcgagcaaccccagggctggctcgcctcgcaccgacta
atgaaaaccgtgcgctgggacacggtcgatcaggtcccgccgctggacaacagtggacgg
acccggctggtgccgcccaaagcggaataccgtgcgcagttaaagcgcttttatctgcag
aaaaactggactgagctggtggagcaggccagccagatgttctgcgaaggggttaaccac
ttctggctcgatctccagtggtatctctggcagggactcagtcacggcggtcagccgtgg
gaaacctgggctgattctgtcctgctggatttgcgactgttcctgcaacgtctgcccggg
ctggatctgcttgcctggagcgatggcaccccgtttgccgatgaggttacacagggttgg
atagccgggaaggtgaatgaggatgagagggtattccatgatgacgctgccacggtagcc
aacagccaggcggatgatgtgctgtcgctggaggcggaggcgatggaaaagggtgacagc
gagagcccggaagccgcgatcgcctggcttcagatccgacctggcgcggagacaccacgc
caacgctggctgatgcgcctgctgatggcccgggtggccgaacagtacggtcgcaacgac
atggccttgcatctgctgggtgaactgaccgccagcgccccgcggctgacgttggttgac
tgggagcctgccctgttgtttgaagtgcaggcccgtcgcctgaagctgttacgcatgaaa
gccggccgcagcgcggccgaaaaagcccttatgatgcccgaaatggacaccttgctggct
ggccttatcgctatcgaccctgcccgggccatggtgctctgtggctaa

DBGET integrated database retrieval system