KEGG   Erwinia amylovora ATCC 49946: EAM_0382
Entry
EAM_0382          CDS       T01199                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
eay  Erwinia amylovora ATCC 49946
Brite
KEGG Orthology (KO) [BR:eay00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eay02044]
    EAM_0382
Secretion system [BR:eay02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EAM_0382
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: CBJ45057
Position
467051..468133
AA seq 360 aa
MERNSQPARTGLTLALNKDIWRANFYRFCQLLEQENPDSPRLGATSHPGSDPVRFRPWPG
MGFPVSTLKTVETDEDHPELPPTVRTTFLGMYGVDSPLPSSYLDDIAQRREGHEAVSSFL
DIFSHRITTQYYRIWRKYAYPATFEAGGRDATSQCLLGLVGLGIPGTAEQVTTPISRFLA
LLGTMRLPTRNAEGIRALVRLLAPDTRATLIQPDSVRVHINNRSGLGAGNRVRLSQRATL
GKTAKEACSRVLVVLETENPQEAEGWLPGGHMHTDLLALMRVYLGYRSAARLRLTVPVRL
LPEPRLGNSRRIQLGRTGLAGLKDGKLSIDRQTLTVSLGCYEGLQCASLPPAEDGHYRFK
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggaacgaaattcacagccagcacgtaccgggctgacgttagccctcaataaagacatc
tggcgggccaacttttaccgcttttgccagctgctggagcaggaaaacccggattcaccc
aggctgggggcgaccagccatccgggcagcgatccggtacggttcaggccgtggccgggg
atgggttttccggtcagtaccctgaaaaccgtggagaccgacgaagaccatcccgaactt
cctccgaccgtacgcaccacttttttgggcatgtacggcgtggattcaccgctacccagt
tcgtatctggatgatattgcacagcggcgggaaggacatgaggcagttagctcatttctg
gatatcttcagccaccgtatcaccacccagtattaccgtatctggcgcaaatatgcctac
ccggccacttttgaagctggcggccgtgacgccacctcacagtgtctgctggggctggtg
gggctgggtattccgggcacggctgaacaagtgaccacccccatctcgcgttttctggcg
ttgctgggcaccatgcgtttacctacccgcaacgccgaggggatacgcgccctggtccgt
ctgctggcgcctgatacgcgggccaccctcatccagcccgattcggtcagggtccatatc
aacaaccgcagcggtctgggggcggggaaccgcgtccggctgtcgcagcgggccacgctg
ggtaagaccgctaaagaagcctgcagcagggtgctggtggtgctggagactgaaaatccg
caggaggcagaaggctggttaccggggggtcacatgcacaccgacctgctggcgctgatg
cgcgtctatctgggatatcgcagcgctgcccggctgcgccttaccgtaccggtgcggttg
ctgcccgaaccccgactgggtaacagcagacgcatacagctggggcgaactgggctggcc
ggtcttaaagacggcaaactcagtattgatcggcaaaccctgacggtcagcctgggctgc
tatgaggggctgcaatgtgcttcattgcctccggctgaagatggccattaccgctttaaa
taa

DBGET integrated database retrieval system