KEGG   Erwinia amylovora ATCC 49946: EAM_0383
Entry
EAM_0383          CDS       T01199                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11906  type VI secretion system protein VasD
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
eay03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eay00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EAM_0383
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eay02044]
    EAM_0383
Secretion system [BR:eay02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EAM_0383
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: CBJ45058
Position
468159..468683
AA seq 174 aa
MTRVNRRRALTLMACCLLAGCGLTRAVTDGTVNMTKSIFYKKIRMLHLDFTPRTAMNADG
AQIPLATMVRIYQLKDRKAVDAADYRTMLRNADAALKDDLVVSKELLVMPKGSMTLNMPM
DENAQFVAVIGLFNRPDLQDNRWRLVLTRDDLDPDKPRTAELGDGWLSLVPLKE
NT seq 525 nt   +upstreamnt  +downstreamnt
atgacaagagtaaaccggaggcgggcgctaacgctcatggcctgctgcctgcttgcaggc
tgcggcctgacccgtgccgtcaccgacggcacggtaaacatgacgaagtccatcttctat
aaaaaaatcagaatgctgcatctggattttaccccgcgtaccgcgatgaacgccgatggt
gctcagatcccgctggcaaccatggtgaggatctaccagctgaaggaccgtaaggcggtt
gatgcagccgattaccggactatgctgcgcaacgccgacgcggcgctgaaagatgacctt
gtggtgtcaaaagagctgctggtgatgcccaaaggcagcatgacgctgaacatgccgatg
gatgagaacgcgcagtttgttgccgtgatcgggttatttaaccgtcccgatctgcaagac
aaccgctggcggctggtactgacccgtgacgatcttgacccggataaaccgcgcaccgct
gaactgggcgatggctggctcagccttgtgccgctaaaggagtga

DBGET integrated database retrieval system