KEGG   Erwinia amylovora ATCC 49946: EAM_0572
Entry
EAM_0572          CDS       T01199                                 

Definition
(GenBank) putative lipoprotein
  KO
K11906  type VI secretion system protein VasD
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
eay03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eay00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EAM_0572
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eay02044]
    EAM_0572
Secretion system [BR:eay02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EAM_0572
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: CBJ45247
Position
636187..636699
AA seq 170 aa
MHRLSIFRLVTQAFLLAAFTLLAGCVSTSRSVPAQYSLVFQAHPQINNSAPLKVRVLLLK
SDADLMAADFYSLQTNPQGVLGQNLLNSEQFFLMPGQTDKKLAGQSSPEARYIGIMAEYQ
MLDGKKWRISLPVPLPAERHFYQFWQGDADNLRADIIADINGVRVVNARD
NT seq 513 nt   +upstreamnt  +downstreamnt
atgcacagactttcgatttttcgcctggtgactcaggcgtttttgctggcagcctttacc
ctgctggcaggttgtgtttccacttcacgcagcgtccccgcgcagtacagcctggtcttt
caggcacatcctcagatcaacaactcggctccgctgaaagtacgggtgctgctgctgaag
tcggatgcggatttaatggcggccgatttctattcgctgcaaaccaatccgcagggcgtg
ctggggcaaaacctgttgaacagcgagcagtttttcctgatgccggggcaaactgacaaa
aaactggccgggcagagcagcccggaggcgcggtatatcggcattatggcggaatatcaa
atgcttgatggcaaaaagtggcgtatttcactgccggttcctctccccgcagaacgccat
ttttatcagttctggcagggggatgcggataatctgcgtgccgacatcatcgccgatatc
aacggtgtccgtgttgttaatgcccgcgattag

DBGET integrated database retrieval system