KEGG   Erwinia amylovora ATCC 49946: EAM_0574
Entry
EAM_0574          CDS       T01199                                 

Definition
(GenBank) putative outer membrane protein
  KO
K11892  type VI secretion system protein ImpK
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
eay03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eay00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EAM_0574
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eay02044]
    EAM_0574
Secretion system [BR:eay02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EAM_0574
SSDB
Motif
Pfam: DotU OmpA
Other DBs
NCBI-ProteinID: CBJ45249
Position
638080..639321
AA seq 413 aa
MKQQRHSDAAQTGMNGANGHNPLVAAANPLLNAIPQIRHSVAHPDPAGLRQRLVDEIRQF
EMHCQRAGLPWEVIIGARYCLCTALDEAAALTPWGGRGVWPGNGLLVTFHNETWGGEKFF
QLLARLSQTPREQIALLELINFCLQLGFEGRYRVMDNGRSQLETIRQRLLQMIRSVRGGY
APPLSAHPEDHPVTRQLWRPLVPLWACSAVVGFLACLLYILLNWRLGDYTSPVLASIYQT
TLPEVSIHNPAPPPPAAVNLKTFLRPEIEQGLVAVRDEADRSVVTLKGDGLFTSASTEVR
GRYAEVLDRVAAAMNSVSGRILVVGYSDNVPIRSARFASNYELSLARAQSVSEQLQQHLT
QPQRVKAEGRGESNPLAPNNSAGNRARNRRVEITLLVSPGSTRAELNDMAQGN
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgaaacagcaaagacattcagatgccgcccagacgggtatgaacggtgccaacggtcat
aatcccctggtcgccgccgccaacccgttgctgaacgccattccccagatccgccattcg
gtcgcccatcccgatcctgccggactgcgtcagcggctggtcgacgaaattcgccagttt
gaaatgcattgccagcgtgccgggctgccctgggaagtgattatcggcgcacgttactgc
ctgtgtaccgcgctggatgaagccgctgcgcttactccctggggtgggcgcggcgtctgg
cccggcaacgggctgctggttacctttcataatgaaacctggggcggcgaaaaatttttc
cagctgctggcgcgtctgtcgcagacgccacgtgagcagatcgccctgctggagctgatt
aatttctgcctgcagctgggctttgaagggcgctaccgggtgatggataacgggcgctcc
cagctggagaccatcaggcagcggctgttgcagatgatccgctcggtgcgcggtggctat
gcaccgccgctgtcggcacatcccgaagaccatccggtaacgcgacaactgtggcggccg
ctggtgccgctgtgggcctgtagcgccgtggtgggcttcctcgcctgtctgctctatatc
ctgcttaactggcggctgggtgattataccagcccggtgctggcctcgatttaccagacc
acgctaccggaagtgagcattcacaatccggctccgccgccgccggcagcggttaatctg
aaaacctttctgcggcccgaaatcgaacaggggctggtggcggtgcgcgacgaggccgac
cgcagcgtagtgacgctaaaaggtgacggcctgtttacctccgcctccaccgaagtccgt
ggccgctacgccgaggtgctggatcgcgttgccgccgcgatgaacagcgtgagcggccgc
attctggtggtgggctacagcgataatgtaccgatccgcagcgcgcgctttgcctccaac
tacgagctatctctggcgcgtgcgcagtcggtttccgagcaattgcagcagcatcttaca
cagccgcagcgggtgaaagcggaagggcggggcgaaagcaacccgctcgcgccgaacaac
agcgccgggaaccgcgcccgcaaccgacgcgtagagatcaccctgctggtttcgccgggc
agcacccgggccgagctgaacgacatggcgcaaggaaattaa

DBGET integrated database retrieval system