KEGG   Erwinia amylovora ATCC 49946: EAM_0588
Entry
EAM_0588          CDS       T01199                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11898  type VI secretion system protein ImpE
Organism
eay  Erwinia amylovora ATCC 49946
Brite
KEGG Orthology (KO) [BR:eay00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eay02044]
    EAM_0588
Secretion system [BR:eay02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   EAM_0588
SSDB
Motif
Pfam: ImpE TPR_19
Other DBs
NCBI-ProteinID: CBJ45263
Position
653320..654141
AA seq 273 aa
MHSLQYLMDGQSLAETLARLESQIKRQPGDADLRASFVQLLCLAGNWSRAQTQLKSWLAL
KPQAQPTVTLLEQAINGERQRAAVFAGEATPRMPGAAWNWAEQLLAALAADAGGDNAEAQ
RLRAAAIDAAQLNPGQLTHQGEQHAFAWLADGDGRLGPVCELIANGQYSWLPFGAISEMR
FQAPVSVTDLVWRHTLVRLVDGSEQVCQIPVRYPFGEQADDRYRLATLTEWQPLAGDDQQ
FSGHGQKCWFSADGEFPLLGMETLAFSDAEPAL
NT seq 822 nt   +upstreamnt  +downstreamnt
atgcactctctacaatatctgatggacggccagtcgctggccgaaaccctggcccggctg
gaaagccagattaagcgccagcccggcgatgccgatttacgtgccagcttcgtccagctg
ctgtgcctggcgggcaactggagccgggcgcagacgcagctgaaatcctggctggcgttg
aagccgcaggcacagccgacggtcacgctgctggagcaggcaattaacggtgaacgccag
cgggcggcggtattcgccggtgaagcgacgccacggatgccgggcgcggcctggaactgg
gcagagcaactgctggccgcgctggcggccgatgccgggggtgacaatgccgaggcgcaa
cggctgcgcgctgccgctatagatgcggcgcagctcaatcccgggcagttgacgcaccag
ggcgagcagcacgcttttgcctggctggccgacggtgacggacggctcggccccgtctgc
gaactgatcgccaacggccagtacagctggctgccgttcggcgccatcagcgaaatgcgc
ttccaggctccggtcagcgtcaccgatctggtgtggcggcatacgctggtcaggctggtg
gacggcagcgaacaggtgtgccagatcccggtacgctatccgtttggcgaacaggccgac
gaccgctaccgtctggccacgctgaccgaatggcagccgctggcgggcgacgaccagcag
ttcagcggccacggtcagaaatgctggttcagcgccgatggcgaattcccgctgctgggc
atggagacgctggcgtttagcgatgcagagccagcgttatga

DBGET integrated database retrieval system