KEGG   Erwinia amylovora ATCC 49946: EAM_0644Help
Entry
EAM_0644          CDS       T01199                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
eay00260  Glycine, serine and threonine metabolism
eay00750  Vitamin B6 metabolism
eay01100  Metabolic pathways
eay01110  Biosynthesis of secondary metabolites
eay01120  Microbial metabolism in diverse environments
eay01230  Biosynthesis of amino acids
Module
eay_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:eay00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EAM_0644 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    EAM_0644 (thrC)
Enzymes [BR:eay01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     EAM_0644 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: CBJ45319
Position
721808..723094
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVKQGLGKQQGLFFPLELPEFELTDIDNMLNMDFVTRSSKILS
AFIGDEIAPHQLNERLKTAFTFPAPVVEVTDDIAALELFHGPTLAFKDFGGRFMAQMLAY
VSGADEQITILTATSGDTGAAVAHAFYGMENVRVVILYPQGKISPLQEKLFCTLGGNIET
IAIDGDFDVCQSLVKQAFDDEELKKAIGLNSANSINISRLLAQICYYFEAVAQLPQEKRN
QLVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLANGQWTPNPTVATLSN
AMDVSQPNNWPRVEEIFRRKTWRLTDLGYGAVDDETTQAAMRELADLGYLSEPHAAIAWR
LLRDGLQEGEFGLFLGTAHPAKFKESVEEILQRTLPLPDALAERADLPLLSHSMKAQFTE
LRAFLLNT
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtataatcttaaggatcacaacgagcaggtaagcttcgcccaggcggtgaag
caggggctgggcaaacagcagggcctgttctttcccctcgagctacctgagttcgaactg
accgatattgataacatgctgaacatggattttgtgactcgtagcagtaaaatcctctcg
gcgtttatcggggatgaaattgctccgcaccagctgaatgagcgtttgaaaacggcgttc
accttcccggcaccggtggtggaagtcactgacgatatcgccgcgttggagctgttccac
ggtccgacgctggcgtttaaagactttggcggccgctttatggcacagatgctggcttat
gtcagcggcgcagatgagcagatcactatcctcaccgccacttccggcgataccggagcc
gccgttgctcatgctttctacggcatggaaaacgtgcgcgtggtgatcctttatccacag
ggcaaaatcagtccgctacaggaaaaactgttctgtaccctcggcggtaatatcgaaact
atcgccatcgacggcgatttcgatgtttgccagtcactggttaaacaggcatttgacgat
gaagaactgaaaaaggccattggccttaattcggcgaactcgattaatatcagccgcctg
ctggcgcagatctgctactactttgaagccgttgcgcagctgccgcaggagaagcgcaat
cagctggtgatatcggtgccgagcggcaactttggtgacctgacggctggcctgctggcg
aaatctcttggcttgccggtgaagcgttttattgccgccaccaacgccaatgataccgtg
ccgcgctttctggccaacggccagtggacgccaaatcccaccgtggcaacgttgtcgaac
gcgatggacgtcagccagccaaataactggccgcgcgttgaagagattttccgccgcaaa
acctggcgcttaacggatcttggctacggtgccgtcgacgatgagaccacccaagcggcg
atgcgtgagctggccgacctcggttacctttctgagccacatgcggctatcgcctggcgg
ctgctgcgagatggattacaggaaggggagtttggcctgttccttggtactgcacacccg
gctaagtttaaagagagcgtggaagagatcctgcaacgcactttgccgctgccggatgcg
ctggccgagcgcgccgatctgccgctgctgtctcacagcatgaaagcgcaatttaccgaa
ctgcgtgcgttcctgctgaacacctaa

DBGET integrated database retrieval system