KEGG   Erwinia amylovora ATCC 49946: EAM_0757Help
Entry
EAM_0757          CDS       T01199                                 

Definition
(GenBank) putative thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
eay00071  Fatty acid degradation
eay00280  Valine, leucine and isoleucine degradation
eay00310  Lysine degradation
eay00362  Benzoate degradation
eay00380  Tryptophan metabolism
eay00620  Pyruvate metabolism
eay00630  Glyoxylate and dicarboxylate metabolism
eay00640  Propanoate metabolism
eay00650  Butanoate metabolism
eay00900  Terpenoid backbone biosynthesis
eay01100  Metabolic pathways
eay01110  Biosynthesis of secondary metabolites
eay01120  Microbial metabolism in diverse environments
eay01130  Biosynthesis of antibiotics
eay01200  Carbon metabolism
eay01212  Fatty acid metabolism
eay02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eay00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EAM_0757
   00630 Glyoxylate and dicarboxylate metabolism
    EAM_0757
   00640 Propanoate metabolism
    EAM_0757
   00650 Butanoate metabolism
    EAM_0757
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EAM_0757
   00072 Synthesis and degradation of ketone bodies
    EAM_0757
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EAM_0757
   00310 Lysine degradation
    EAM_0757
   00380 Tryptophan metabolism
    EAM_0757
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EAM_0757
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EAM_0757
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EAM_0757
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eay04147]
    EAM_0757
Enzymes [BR:eay01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     EAM_0757
Exosome [BR:eay04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EAM_0757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CBJ45432
Position
852236..853387
Genome map
AA seq 383 aa AA seqDB search
MIVAACRTPVGRAYGSLANVPPQALLAPLFGKLLAALPAGFTAIDEVIIGNATGGGGNIA
RLAALAAGLPLAVPGVTVDRQCGSGLEAVINACRLVQARAGECYLAGGVESVSTAPWRVE
KPATLRQMPRFYPRARFSPEEIGDPEMGIAAENVARQCAISRERQDRFALRSHQRALAAA
QQGAFREEIVALNLDRCQVENDECPRPDTSLARLAALPPVFAADGSVTAGNCCPLNDGAA
LLLVMSRRMARDCGFSQGLLFADACSAGVDPNLLGLGPVPATQKLLRRQPGLALDRVEVI
EFNEAFAAQVLASVDALGIAEHRINQQGGAIALGHPYGASGAIMVTRLFSQLVSQRQSEG
FGLAMLGIAGGLGLSALFKGVRL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtgattgtcgccgcctgccgcacgcccgtcggcagggcttatggctcgctggccaacgtg
ccgccgcaggcgctgctggccccgctgtttggcaagctgctggcggcattacccgctggg
tttacggcgattgatgaggtgattatcggcaacgccaccggcggcggcggcaatattgcc
cggctggcggcgctggcggccgggttaccgctggcggtgcctggcgtgacggtggaccgc
cagtgcggctccgggctggaagcggtgattaacgcctgtcggctggtgcaggccagggca
ggtgaatgttatctggccggcggggtagagagcgtcagcaccgcgccctggcgggtggaa
aagcccgccacgctaaggcagatgccgcgcttttatccgcgcgcacgtttttcgccggaa
gagatcggcgacccggaaatgggcatcgccgccgagaacgtggcgcgtcagtgcgccatc
agccgggaacgccaggaccgctttgcgctgcgcagccatcagcgcgcgctggccgccgcg
cagcagggcgcattccgcgaggagatcgtcgcgcttaaccttgaccgttgccaggttgaa
aacgacgaatgcccacggcctgatacttcgctggcgcggctggcggcgttaccgccggta
tttgccgccgatggctcggtgacggcgggtaactgctgcccgctgaatgacggcgctgcg
ctgctgctggtgatgagccgccgcatggcgcgggattgcggcttcagccaggggctgctg
tttgccgatgcctgtagcgcgggggttgacccgaatttactggggcttggcccggttccc
gccacgcaaaagctgctgcggcgtcagccgggcctggcgttggatcgggttgaggtgatc
gagtttaatgaggcttttgccgcccaggtgctggcatcggtagatgcgttgggcattgct
gaacacaggatcaaccagcaggggggcgctatcgcactggggcatccttacggcgcttcc
ggggcgatcatggtaacgcggctgttcagccagctggtaagtcagcggcagagcgaaggc
ttcgggctggcgatgctggggatcgccggtgggctggggttgagcgcgctgtttaagggc
gtgcggctgtaa

DBGET integrated database retrieval system