KEGG   Erwinia amylovora ATCC 49946: EAM_1583Help
Entry
EAM_1583          CDS       T01199                                 

Gene name
ipk
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
eay00900  Terpenoid backbone biosynthesis
eay01100  Metabolic pathways
eay01110  Biosynthesis of secondary metabolites
eay01130  Biosynthesis of antibiotics
Module
eay_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:eay00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EAM_1583 (ipk)
Enzymes [BR:eay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     EAM_1583 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: CBJ46258
Position
complement(1706457..1707320)
Genome map
AA seq 287 aa AA seqDB search
MITTWPAPAKLNLFLYITDRRPDGYHNLQTLFQFLDYGDTLTIETDQSGELQLLSPLVGV
PDDENLIIRAAKLLRQQAQISGTLPANSGAKLAVTKRLPMGGGLGGGSSNAATVLVALNH
LWQTGFSFAQLADFGLQLGADVPVFVHGFAAFAEGVGERLTPVSPAEKWYLVMHPGISIA
TPLVFNDPALTRNTPHREISALLSSEFRNDCEAVVRNRFREVEQLVSWLLEYAPSRLTGT
GACVFAEFDTECAARQVFELAPQGLQGFVARGVNVSPLHRTLTQQMS
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgataaccacttggcctgcgccggcaaaactcaatctgtttctgtacatcactgaccgt
cgtccggacggctatcataatctgcagacgctgtttcagttcctcgattatggcgatacc
ctgacgattgaaactgatcagagtggcgagctgcaactgttaagcccgctggtcggcgtg
cccgacgatgaaaatctgattattcgcgcagcaaaattgctgcgccaacaggcacaaata
tccggcacactgcctgctaactccggtgcaaagctcgcggtgacaaaacggttgccgatg
ggcggcggtttgggcggcggctcttccaacgccgctacggtgctggtggcgctgaatcat
ctgtggcagaccggcttcagtttcgcccagctggccgactttggcttgcagctgggcgcc
gacgtcccggtatttgtccacggctttgccgcatttgccgagggcgttggcgagcggctg
actccggtttctcccgctgaaaaatggtacctggtgatgcacccgggcatcagtatcgcc
actccgttagtctttaacgatccagcactgaccagaaacacgccacatcgggaaatcagc
gccttattatcgagcgaattccgcaatgattgtgaagcagtcgtaagaaatcgttttcgc
gaggttgaacagctcgtttcctggctgctagaatacgcgccgtcacgcctgaccgggacg
ggtgcttgtgtgtttgcagaatttgacaccgagtgcgcggctcgtcaggtgtttgagctg
gctccgcaagggttgcaggggtttgtagcgcggggcgttaacgtctcaccgctgcaccgc
acccttacgcagcaaatgagttaa

DBGET integrated database retrieval system