KEGG   Erwinia amylovora ATCC 49946: EAM_2052Help
Entry
EAM_2052          CDS       T01199                                 

Gene name
phoA
Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
eay00730  Thiamine metabolism
eay00790  Folate biosynthesis
eay01100  Metabolic pathways
eay02020  Two-component system
Module
eay_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:eay00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    EAM_2052 (phoA)
   00790 Folate biosynthesis
    EAM_2052 (phoA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EAM_2052 (phoA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eay04147]
    EAM_2052 (phoA)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:eay00537]
    EAM_2052 (phoA)
Enzymes [BR:eay01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     EAM_2052 (phoA)
Exosome [BR:eay04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EAM_2052 (phoA)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:eay00537]
 Enzymes
  EAM_2052 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Nuc_recep-AF1
Motif
Other DBs
NCBI-ProteinID: CBJ46727
Position
complement(2201742..2203145)
Genome map
AA seq 467 aa AA seqDB search
MKHQALALSIISSLICSSAVADIASWHRAARGDITQPGGARRLDIDQTAAIKAALSNSRA
KNVILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYALDKKTHKPDYVTDS
AASATAWATGVKSYNGAIGVDVTGKAHPTLLELAKGAGRATGNVSTAELEDATPAAQIAH
VTSRKCYGPVETSELCSTNALENGGKGSIAEQLLNTRADVNFGGGGKTFAETARGGEWQG
KTLQAQAKLRGYQLVSDLDGMNSLSSASNEKPVLGLFAVGNMPVRWKGPKASYHGNLAAK
PVTCEVNAERPASTPTLAQMTDKAITLLSSHPQGFFLQVEGASIDKQDHAANPCGQIGET
VDLDEAVQKALQFARKDGNTLVIVTADHAHSSQIIANDSKAPGLTQTLITKDGSPMTISY
GNSEEESQGHTGSQLRIAAYGPHAANVVGLTDQTDLFYTIKAALGMH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaccaagccctggcactgtcaataataagttcactgatttgttcctctgccgtt
gccgatattgctagctggcatcgcgcagcccggggcgatatcacccagccgggtggcgct
cgtcgtctggacatcgaccaaaccgcagcgattaaggccgctctgagcaatagcagggcg
aaaaatgtcattttgctgatcggtgatggcatgggtgattctgagatcacagcggcacgt
aactatgccgaaggggcgggcggtttctttaaaggcatcgacgcactgccgctcacgggg
cagtacacccactatgcactggataagaaaacgcataagcccgattacgtcaccgattct
gcagcatcggccaccgcctgggcgaccggggtgaaatcctacaatggagccatcggggtt
gatgttacgggtaaggctcatcctacgctgcttgaactggcgaagggggctggcagggcg
accggcaatgtttctactgcggagctggaggacgcaacgccggcggcgcagattgcccat
gtcacttcacgtaagtgttatggcccggtagaaaccagcgaactgtgttcaaccaatgcc
cttgagaacggcggtaaggggtcgatagcggaacagctgttgaatacacgcgcagacgtc
aatttcggcggcggtggaaaaacctttgcggaaaccgcgcgcggcggcgaatggcagggt
aaaacactgcaagcgcaggcgaagctgcgtggctatcagctggtcagcgacctcgacggg
atgaattcgctcagtagcgccagcaatgagaaaccggtactgggactgtttgccgtcggt
aatatgccggtgcgctggaaagggcctaaggccagctatcacggtaatcttgccgctaaa
ccggtcacctgtgaagtcaacgctgaacgtcctgcctccacgccaactctcgcgcagatg
accgataaagccattacgttactgagcagccatccgcaaggcttcttcctgcaggttgaa
ggtgcctctattgataagcaggatcacgcggcgaatccgtgtgggcagatcggcgaaacg
gtcgatttggatgaagcagtgcaaaaggcgctccaattcgcccgcaaagatggtaataca
ttggttatcgtcaccgccgaccatgcccactccagccagattatcgctaacgacagcaag
gctccgggcctgacgcagacgctgatcaccaaagacggcagcccgatgaccatcagttac
ggtaactcggaagaagagtcacaggggcataccggtagccagctgcgtattgctgcgtac
ggtccacatgcggcgaatgtggtggggctgactgaccagacggatctgttttataccatt
aaggcggcgctgggaatgcattaa

DBGET integrated database retrieval system