KEGG   Erwinia amylovora ATCC 49946: EAM_2315Help
Entry
EAM_2315          CDS       T01199                                 

Gene name
hisQ
Definition
(GenBank) histidine ABC transporter, permease protein
  KO
K10016  histidine transport system permease protein
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
eay02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eay00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    EAM_2315 (hisQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eay02000]
    EAM_2315 (hisQ)
Transporters [BR:eay02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    EAM_2315 (hisQ)
   Histidine transporter
    EAM_2315 (hisQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: CBJ46989
Position
complement(2509665..2510351)
Genome map
AA seq 228 aa AA seqDB search
MLYGYSEVIFKGALVTLELALSSVVFAVLLGLIGAAAKLSNSRPLAAMSEVYTTLIRGVP
DLVLMLLIFYGLQIALNQLTDFFSFAQFDIDPMVAGIITLGFIYGAYFTETFRGAWMAVP
KGQLEAATAFGFTRSQTFRRILFPAMMRFALPGIGNNWQVILKATALVSLLGLEDVVKAT
QLAGKSTWQPFWFAIVAGVIYLIFTTLSNGVLWWLERRYTVGVKRAEL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgctgtatggctactctgaagtcatttttaaaggcgcgctggtgacgctggagctggcg
cttagctcggtcgtgtttgccgtgctgctaggattgattggcgccgcggccaaactctcc
aacagccgcccgttggcggcgatgtctgaagtttacaccacgctgatccgcggcgttccg
gacctggtgctgatgctgctgattttctatggtttgcagattgcgcttaaccagctgact
gatttcttcagcttcgcccagttcgatattgatccgatggtggccgggattatcaccctc
ggctttatctatggggcttacttcactgaaacctttcgcggtgcctggatggcggtgccg
aaagggcagctcgaagcggccaccgcctttggtttcacccgctcccagacttttcgccgt
atcttatttccggccatgatgcgttttgcgctaccggggatcggtaataactggcaggtg
atcctgaaagccacggcgctggtatcgctgctcggactggaagacgtggtgaaggccacc
cagctggctggtaaatcgacctggcagccgttctggtttgcgatagttgcgggcgtgatt
tacctgatttttaccacgctctctaacggggtgctgtggtggctggaacgccgttacacg
gtaggcgtgaaaagggctgaactatga

DBGET integrated database retrieval system