KEGG   Erwinia amylovora ATCC 49946: EAM_2374Help
Entry
EAM_2374          CDS       T01199                                 

Gene name
glk
Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
eay00010  Glycolysis / Gluconeogenesis
eay00052  Galactose metabolism
eay00500  Starch and sucrose metabolism
eay00520  Amino sugar and nucleotide sugar metabolism
eay00521  Streptomycin biosynthesis
eay01100  Metabolic pathways
eay01110  Biosynthesis of secondary metabolites
eay01120  Microbial metabolism in diverse environments
eay01130  Biosynthesis of antibiotics
eay01200  Carbon metabolism
Module
eay_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eay_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eay00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAM_2374 (glk)
   00052 Galactose metabolism
    EAM_2374 (glk)
   00500 Starch and sucrose metabolism
    EAM_2374 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    EAM_2374 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    EAM_2374 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    EAM_2374 (glk)
Enzymes [BR:eay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     EAM_2374 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: CBJ47048
Position
complement(2570478..2571443)
Genome map
AA seq 321 aa AA seqDB search
MNKYALVGDVGGTNARLALCEIENGAISRAKTFSTADYGSLEAVIRAYLAEHQQDVKHGC
IAIACPITEDWVEMTNHDWAFSTNSLKANLAFDSLEIINDFTAVSMAIPMLTEQDLMQFG
GSAPVADKPVAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAANSEEEDLILEVLREE
LGHVSAERILSGSGLVNLYRAIVKSDNRLPDNLKPRDVTERALQDTCTDCRRALSMFCVA
MGRFGGNLALNLGTFGGVYIAGGIVPRFLEFFKASGFRAAFEDKGRFRDYVAPIPVYLIT
HDYPGLLGAGGHLRQTLGRVL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaataagtatgctttggtgggagatgtcggcggcacgaatgcgcgcctggcactatgt
gaaattgaaaacggtgccatctcccgggccaaaacgttctccactgccgattatggcagc
ctggaggcggtgatccgtgcttatctggctgaacaccagcaggatgtcaaacacggttgt
atcgccatcgcctgcccgattaccgaagactgggttgaaatgaccaatcatgactgggct
ttttcaaccaacagcctgaaagcgaatctggcttttgactcgctggagatcatcaacgat
tttaccgccgtctcaatggccatcccgatgctgaccgaacaagatctgatgcagtttggt
ggcagcgcgccggtagcggataaacccgttgccgtatatggtgccggaaccggcctcggc
gttgcgcatctggtgcatgtggacaaacgctgggtcagcctgcctggcgaaggggggcat
gttgattttgccgccaacagcgaggaagaagatctgatccttgaagtgctgcgcgaagag
ctgggccatgtttccgcggagcgaattctctccggcagcggcctggttaacctctatcgg
gcgattgttaagtcagacaaccgcttgccggacaatctgaagccgcgcgacgttaccgag
cgtgcattgcaggacacctgtaccgactgtcgtcgcgcgctgtcgatgttctgtgtggct
atggggcgctttggtggcaacctcgcgcttaacctcggcacctttggcggcgtttatatt
gccggtggcatcgtgccgcgctttcttgaattctttaaagcatcaggcttccgcgcagcg
tttgaagataaagggcgcttcagggattatgtcgcgccaatcccggtctatctcatcacc
cacgattatccggggttactgggtgccggagggcatctgcgtcagacgctgggccgcgtg
ctgtaa

DBGET integrated database retrieval system