KEGG   Erwinia amylovora ATCC 49946: EAM_2482Help
Entry
EAM_2482          CDS       T01199                                 

Definition
(GenBank) Putative aldehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
eay  Erwinia amylovora ATCC 49946
Pathway
eay00040  Pentose and glucuronate interconversions
eay00053  Ascorbate and aldarate metabolism
eay01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eay00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EAM_2482
   00053 Ascorbate and aldarate metabolism
    EAM_2482
Enzymes [BR:eay01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     EAM_2482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Catalase-rel
Motif
Other DBs
NCBI-ProteinID: CBJ47156
Position
complement(2711730..2713319)
Genome map
AA seq 529 aa AA seqDB search
MDHDGQNFIDGKRSSLGDRILSSFDAQSGEALPYLFWQAAEKEAEQACLAARRAFAEYRS
TSAEQRAVFLEAIADELDALDDAFIRLVMQETALPEARIRGERARTSGQMRLFARFLQRG
DFYAARIDCALPDRKPLARPDLRQSRTAIGPVAVFGASNFPLAFSTAGGDTASALAAGCS
VVMKAHSGHMATAEKVAAAIVRAAQKSGMPDGVFNMLYGRDIGAVIVKHPAIQAVGFTGS
LKGGRAICDMAAARPQPIPVFAEMSSINPVILLPGALEKRGEKIARELTDSVVTGCGQFC
TNPGLIIGIRSGAFERFLNDMKTNISASPRQTMLNRGVLHNYQQGLNALHQHNGITWLAG
QEQNGQQASPQLFLAEARLLAQGDALLQEEVFGPVSIVVQVSDEAELKRVIDGLRGQLAA
TLIADPEDVNAFPLLVPLLEQKAGRLLLNGYPTGVEVCDAMVHGGPFPATSDPRGTSVGT
LAIERYLRPVCYQNYPQQWLPDALKDENPLGIMRLINGALTRDAIRGDQ
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggaccatgatggccaaaactttattgatggaaaaagaagcagcctgggtgacagaata
ctgagcagttttgacgcgcaaagcggtgaagcactgccttatctcttctggcaggcggcc
gaaaaggaagcggagcaggcatgtctggcggcccggcgcgcctttgccgaataccgctcg
acctctgcagaacagcgtgcggtatttcttgaagctatcgccgatgaactggacgcgttg
gacgacgcatttatccgcctggtgatgcaggaaacggcgctgccggaagcacgcattcgc
ggtgagcgtgcgcgtaccagcgggcaaatgcgcctgtttgcccggtttttgcagcgtggt
gacttttacgctgcgcgcattgactgcgccttgccggacagaaagccgcttgcgcgcccg
gatctgcgccagtcccgaaccgccatcggcccggttgcggtgtttggagccagtaatttc
ccgctggcgttttccaccgcgggaggcgataccgcttcagcgctggccgcaggctgtagc
gtggtgatgaaagcgcacagcggccatatggccacggcagagaaggttgccgcagctatc
gtgcgcgctgcgcagaaaagcggcatgcccgatggcgtattcaatatgctttacggcaga
gacattggtgctgtcatcgttaagcacccggcgattcaggccgttggctttaccggttcg
cttaaaggcggacgggctatctgcgatatggcggcagcgcgcccgcaacccattccggtg
tttgccgaaatgagcagtatcaatcccgttatcctgctgcctggcgcgctggaaaagcgt
ggtgagaagatagcacgggaactgacggactctgtggtgacgggctgtggccagttctgt
accaacccggggctgattattggcatccgctccggcgctttcgaacgcttccttaatgac
atgaaaaccaatattagcgccagcccacgacaaaccatgcttaatcgcggcgttttgcat
aactatcaacagggacttaacgcgttacatcaacataacggcatcacctggctggcaggg
caggaacagaacggtcaacaggccagcccgcagctgttcctggcagaggccaggctactg
gcccagggcgatgctctgctacaggaagaggtgtttggaccggtctcgattgtggtgcag
gtcagtgacgaagcagaactcaagcgggttatcgacggtctgcgtggtcagctggccgca
accttaatcgccgatccggaagatgtgaacgcattcccgctgctggtgcctttgctggag
cagaaagccggccgtctgctgctgaacggttatcctaccggggtggaagtctgtgacgct
atggtgcatggcggcccctttccggccacctccgatccgcgcggcacttcggtcggcacg
ctggccatcgagcgctatctgcgcccggtctgttatcaaaactacccgcagcagtggctg
ccggacgccctgaaagatgaaaatccgcttggcattatgcggctgattaatggtgcactg
acccgtgacgccatccggggggatcaatga

DBGET integrated database retrieval system