KEGG   Erwinia amylovora ATCC 49946: EAM_P263
Entry
EAM_P263          CDS       T01199                                 

Gene name
traI
Definition
(GenBank) conjugal transfer protein
  KO
K12204  defect in organelle trafficking protein DotC
Organism
eay  Erwinia amylovora ATCC 49946
Brite
KEGG Orthology (KO) [BR:eay00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eay02044]
    EAM_P263 (traI)
Secretion system [BR:eay02044]
 Type IV secretion system
  Icm/Dot secretion system protein
   EAM_P263 (traI)
SSDB
Motif
Pfam: T4SS_TraI
Other DBs
NCBI-ProteinID: CBJ48263
Position
p2:43355..44179
AA seq 274 aa
MKTRLCILLLPALLAGCAGFHFTQTVPATGPDGAPPPGPEAYLSPKKQDASNVSDNRRQM
LTEGGRTTGFRGGKAQRAWELRRDLDARAKQLDATYDFRPLISSRGWLPPVITEATDVAH
VTPDQIRTASRVYEIIQPERFVSNPPTWRSWLMAGLSTVPPDEPTGGLVPENGVQRDIWQ
AAVNEGWAEGRQSADETLEANVNRLTRDYNGMLTYILLRRQNLITAPVVTERQQTVTGNS
NKLTTGDRERRLDSRAGFVTDKSKWEPVINTEKH
NT seq 825 nt   +upstreamnt  +downstreamnt
atgaaaacccgactctgcatcctgctgctgcccgcgctgctggcgggctgcgcgggattt
catttcacgcagacagtgcccgcaaccggccctgacggcgctccgccgcccggacctgag
gcttacctgtcgcccaaaaaacaggatgcgtcgaacgtctctgataaccgccggcaaatg
cttaccgaaggcggacgtacgaccggttttcgtggcggtaaggcgcagcgagcgtgggag
ctacgccgcgatctggacgcgcgcgccaagcaactcgatgccacttatgacttccgcccg
cttatcagcagccgcggatggcttccgccggtcatcacagaagccaccgacgtggcgcac
gttacgcccgatcagatacgcaccgcgagccgagtgtacgaaattattcagcccgaacgc
tttgtcagtaatccaccaacgtggcgcagctggctcatggccgggctgagtaccgtccct
ccggatgaaccgacgggcgggctcgtacctgaaaacggcgtgcagcgggacatatggcag
gcagcagtgaatgagggctgggctgaggggcggcagagcgctgacgagacgctggaggcc
aacgtcaacaggctcacccgcgactataacgggatgctcacttacatcctgctgcgccgg
cagaacctcatcactgcgccggtagttacagagcgacagcagactgttaccggcaatagt
aacaagctcacaaccggcgatcgcgagcgacgtcttgactcgcgggcgggcttcgtgact
gacaaatcgaagtgggaaccagttattaatacggagaaacattaa

DBGET integrated database retrieval system