KEGG   Erwinia amylovora ATCC 49946: EAM_P268
Entry
EAM_P268          CDS       T01199                                 

Gene name
traM
Definition
(GenBank) conjugal transfer protein
  KO
K12214  intracellular multiplication protein IcmL
Organism
eay  Erwinia amylovora ATCC 49946
Brite
KEGG Orthology (KO) [BR:eay00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eay02044]
    EAM_P268 (traM)
Secretion system [BR:eay02044]
 Type IV secretion system
  Icm/Dot secretion system protein
   EAM_P268 (traM)
SSDB
Motif
Pfam: T4BSS_DotI_IcmL
Other DBs
NCBI-ProteinID: CBJ48268
Position
p2:50936..51628
AA seq 230 aa
MQNPVAAQPPDVSAPVLSNPDIYEHAVQAQHERTLGAEFARKCLKGLGWSQVLNVIQAIT
IGLLFWAYIHLPQHYVSTENGRITPFYPTDKPVWSESDVRQFGADTISKAFTLDFVHYRD
QMTAVSPDFSEEGFAGYNQALTTGSNILSLVKDKRMNLTNTVEPGVIARRGVIGDRYTWE
FQYPVTMRLQGQNSSSPPLRYIFTLRIQQADVRRKPRGLEVTQTITNNAG
NT seq 693 nt   +upstreamnt  +downstreamnt
atgcaaaaccctgtagcggctcagccgcctgatgtttccgctcctgtcctgagtaatccg
gatatttatgagcatgccgttcaggctcagcatgagcgcacgctgggtgctgagttcgcc
cgcaaatgcctgaaaggtttaggctggagtcaggtactcaacgttatccaggcgatcact
atcggcttgctcttttgggcctatatacatctgccgcagcactacgtctctacggaaaac
ggccgcattacgcctttctacccgacggacaagccggtctggagcgaaagcgacgtaagg
cagttcggtgctgacacgatcagtaaagcctttacgctcgacttcgtgcattaccgcgat
cagatgaccgccgtctcccctgatttctcagaggaaggctttgccggttataaccaggcg
ctgacgactggctctaacatcctgtcgctcgtcaaagacaagcgtatgaacctcaccaat
accgttgagccgggtgtaatagcgcgccggggtgtgattggcgaccggtacacctgggag
ttccagtacccggttacgatgcgcctgcagggacagaacagcagcagcccgccgctgcgc
tacatatttacgctgcgcattcagcaggccgatgtgcgacggaagccgcgcggtctggag
gtcacgcagactatcaccaacaatgcaggttaa

DBGET integrated database retrieval system