KEGG   Erwinia amylovora ATCC 49946: EAM_P270
Entry
EAM_P270          CDS       T01199                                 

Gene name
traO
Definition
(GenBank) conjugal transfer protein
  KO
K12209  intracellular multiplication protein IcmE
Organism
eay  Erwinia amylovora ATCC 49946
Brite
KEGG Orthology (KO) [BR:eay00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eay02044]
    EAM_P270 (traO)
Secretion system [BR:eay02044]
 Type IV secretion system
  Icm/Dot secretion system protein
   EAM_P270 (traO)
SSDB
Motif
Pfam: TrbI baeRF_family10
Other DBs
NCBI-ProteinID: CBJ48270
Position
p2:52558..53877
AA seq 439 aa
MSDQQNTGGRSIRLMIGLIALGAGVLTGGGYLLWTWLAAPPPAPSSIDMNNLGAMAQNNA
QEQQAYRDLIRENNARGAHNASANNQTFLGSIPLEQDVIKPVEVKAKPPQDKPKDILPPQ
TRGSGRTQEQEKALAEARQKALAALLAKMQQPPETEELPEAKLLGGKDSSWAAWRDSLPG
SEVQLAAARSRQNTLNAPPASVVVEPYWRGPGEICTGVDSDNGATPVLGCIKTGPYAGAV
LKAPEGAKLSGNGVIIHFTTMTLNSKAYKIDAYGLDDKTLVANIASDVDHHYGRRILLPA
FLKGIGATGELYAQSNTQVLTNGFNTVTARPSAPDGSAVAGVIVGGAAEQAAQVLTNDAG
RLADRTVTVDYGKVVAIQFMSGVYSTDAEAPQDTTSGNTGAAAPAGWRNNPTPTAAYLRD
EAQARIRDARQRKTGDALE
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgagcgatcaacaaaataccggcgggcgtagtatccgcctgatgatagggctaatagcg
cttggcgcaggcgtgctgacaggaggtggttatctgttatggacatggcttgctgcgcca
ccgcccgcgccatccagcatagacatgaacaacctcggcgccatggcgcaaaataatgcg
caggagcagcaggcctatcgagatcttatccgtgaaaacaatgcgcggggagcgcataac
gcatcggcgaacaatcagactttccttggcagcattccgctggagcaggacgtcattaaa
cctgtggaagtgaaggctaagccacctcaggacaagccaaaggatattctgccaccgcaa
accagaggcagcggccgcacgcaggagcaggagaaggcgctggcagaagcccgacagaag
gcgctggccgcactgctggcaaagatgcaacagcctccagaaacggaagagctgcctgag
gcgaagttgcttggtggaaaggacagcagctgggctgcctggcgcgattcgctgcccggc
agtgaagttcagctggccgccgcgcgcagccggcagaacacgctgaatgctccgccggca
tctgtagtagtggaaccgtactggcgagggcccggggaaatctgtacgggtgttgactca
gataacggcgccacgccggtgctgggctgcatcaaaacggggccttatgcaggggcggtg
ctgaaggcgcctgagggagcgaagctctcaggcaacggcgtcattattcacttcaccacc
atgaccctgaacagtaaggcctacaaaatcgatgcttacgggctggacgacaagacgctc
gtggcaaacatcgcatctgacgtcgatcatcattacggtcgtcgtattctgctgcccgca
ttcctcaagggaatcggcgcgaccggcgagctctatgcgcagtcgaatacgcaggtgctg
actaatggattcaacaccgttaccgcgcggccgtccgcgccggatggctcggcggtggca
ggcgttattgttggtggtgcggcagagcaggccgcgcaagtgctgacgaatgatgcgggc
cgtctggcggacaggacggttacagttgactacggcaaggtagtagccattcagttcatg
agcggcgtgtacagcaccgatgctgaagcgccgcaggacacaacatcaggtaacactggc
gcagcagctccggctggctggcgcaacaatccaacccctaccgcagcctatctgcgagac
gaagcgcaggcgcgcattcgcgacgcccgacagagaaaaacaggagacgcccttgaatga

DBGET integrated database retrieval system