KEGG   Erwinia amylovora ATCC 49946: EAM_P271
Entry
EAM_P271          CDS       T01199                                 

Gene name
traP
Definition
(GenBank) conjugal transfer protein
  KO
K12211  intracellular multiplication protein IcmG
Organism
eay  Erwinia amylovora ATCC 49946
Brite
KEGG Orthology (KO) [BR:eay00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eay02044]
    EAM_P271 (traP)
Secretion system [BR:eay02044]
 Type IV secretion system
  Icm/Dot secretion system protein
   EAM_P271 (traP)
SSDB
Motif
Pfam: DUF2205 TolA_bind_tri DUF4164 PRIMA1 SlyX HIP1_clath_bdg KLRAQ
Other DBs
NCBI-ProteinID: CBJ48271
Position
p2:53870..54649
AA seq 259 aa
MNEFQTLPADNASPTPPPPQSPPPPKKESLLTRPLFLGQSLPWLAGGALIILGAVLYLYW
PASSTPDAGQLAFGNEDGFSEVKPASVTPQPSAVSQRPVTAPQTGGLSVPVDAIGNPSAG
GALPEEVEKIIREGQEFEAANREAITRLSDTVRAQSAALASMQQRIDSIASENSRLAGQL
TVMNARQDPVAGGHSAAGNKIRRSALSGMRLESVQDGMAWVSWQGRTWAVQSGDSLGGIT
VRDISTADRSVTTSAGVLR
NT seq 780 nt   +upstreamnt  +downstreamnt
ttgaatgagttccagacattaccggcggataacgcctcaccgaccccgccgcctccacag
tctcctccgccaccgaaaaaagagagccttctgacgcgacctttatttctcgggcagtcg
ctgccgtggcttgccggcggcgctctgataattcttggagcggtcttgtatctgtactgg
ccagcatcatctacgcccgacgccgggcagctggcattcggaaacgaagacggattcagc
gaggtaaagccggcttccgttacgcctcagcccagcgctgtatctcagaggcctgtaaca
gcgccacaaaccggagggctcagcgttcccgttgacgctatcggcaatccttcggctggc
ggcgcactgccggaagaagtggagaaaattatccgtgaagggcaggaatttgaagcggca
aatcgcgaggccattacccggctctctgatacggtgcgagcgcaaagtgcagcactggca
agcatgcagcagcggattgattcgattgcgtccgagaacagccggctggcaggtcagctt
acagtaatgaatgcgcgtcaggatccggtagccggcggccacagcgcggcaggcaataaa
atccgtcgctcagcactttcgggcatgcggcttgaaagcgttcaggatggtatggcgtgg
gtcagctggcaggggcggacatgggcggtgcagtccggggacagcctgggaggcatcacc
gtccgcgacataagtaccgctgaccgcagcgttacgaccagtgcgggcgtgctgcgctaa

DBGET integrated database retrieval system