KEGG   Erwinia amylovora ATCC 49946: EAM_P274Help
Entry
EAM_P274          CDS       T01199                                 

Gene name
traT
Definition
(GenBank) conjugal transfer protein
Organism
eay  Erwinia amylovora ATCC 49946
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metal_resist
Motif
Other DBs
NCBI-ProteinID: CBJ48274
Position
p2:55761..56375
Genome map
AA seq 204 aa AA seqDB search
MTVLNVPAPDLLQLVPGISGYDVAPPPVPVDAGPACCGCGTRAQRLWQGPDAVPLCTLCW
LTLNMDSPTAAHGHLAWLPDAPAADIINLQRRALIGLHSKVKSVRKESRKIWNWLARHAR
EVEGMWHTSRAGEFAVAMKQLPPARRAQMQQRLEGCLLILPPDVFSDLTLLLPLGRTAES
AVNTPAWNTYIWSDLYAKPPHPLD
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttcttaacgtgccggcaccggatctgctgcagcttgtgccgggcatcagcgga
tatgatgtcgctcctccgcccgtgccggttgacgcaggtccagcctgctgcggctgcggt
acacgagcgcagcgcctctggcaggggcctgacgccgtgccgctatgtacgctctgctgg
ctgaccctcaacatggacagccccacggctgcacacggacaccttgcctggctgccagat
gcgccggcagcagacatcatcaatctgcagcgacgcgcgcttatcgggctgcacagtaag
gtcaaaagcgtgcgaaaggagtcacggaaaatctggaactggctcgcccggcacgcccgg
gaagttgaaggcatgtggcacacctcacgcgctggggagtttgccgttgccatgaagcag
ctcccgccagcccggcgggcgcagatgcagcagaggcttgaaggctgtttattgatcctt
ccccctgacgttttcagtgaccttaccttgctattgccgctgggacgaaccgcagaaagc
gcggttaataccccggcatggaatacctatatctggagcgacctgtatgccaaaccgcct
catccgctggactga

DBGET integrated database retrieval system