KEGG   Erwinia amylovora ATCC 49946: EAM_P278
Entry
EAM_P278          CDS       T01199                                 

Gene name
traX
Definition
(GenBank) conjugal transfer protein
Organism
eay  Erwinia amylovora ATCC 49946
SSDB
Motif
Pfam: HPIH
Other DBs
NCBI-ProteinID: CBJ48278
Position
p2:61398..61988
AA seq 196 aa
MKRADTEAPATNEKKATITPKRLGWFVMNVFVPAAEITGVVRYTGRSVSRIWQRIRDVTA
GRNAHGYCPADWSQAVSDSGLSPARLARNFRITRWLWWGLMWLTGLPALGCLALLIAAGG
NVSGTGWLRIGCVLLVMSLLTATGFVQVLVASYRLWQLTEKRVSASEEGSFQAFLHETHW
CRTVLSSGLVNRKKIA
NT seq 591 nt   +upstreamnt  +downstreamnt
atgaaaagagctgatactgaagctccggcaactaatgagaagaaggccacaatcacgccg
aagcgcttaggctggtttgttatgaatgtgttcgtgccggccgctgaaattactggcgtg
gttcgctatacagggcgtagcgtctcgcgaatctggcagcgcatccgggatgttaccgcc
ggccgcaatgcacatggctactgcccagctgactggtcacaagcggtttctgacagcggg
cttagcccggcacgtctggcacgcaattttcgcattactcgctggctgtggtgggggctg
atgtggctcaccgggctgccggcgctgggatgtctggcgctgttgatcgcagcaggtggt
aacgtcagcggcaccggctggctgcgcataggctgtgtgctgcttgtcatgagtctgctg
acagctaccggtttcgttcaggtgctggtagcaagctacaggctctggcagctcacggaa
aaaagggtctcggcgtcagaagaaggcagttttcaggcatttctgcatgagacgcactgg
tgtcgtacggttttaagcagtggcttagtgaacaggaaaaaaattgcgtga

DBGET integrated database retrieval system