KEGG   Aromatoleum aromaticum: c1A212Help
Entry
c1A212            CDS       T00222                                 

Gene name
fadA
Definition
(GenBank) Beta-subunit of fatty acid oxidation complex, 3-keto-acyl-CoA-thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
eba  Aromatoleum aromaticum
Pathway
eba00071  Fatty acid degradation
eba00072  Synthesis and degradation of ketone bodies
eba00280  Valine, leucine and isoleucine degradation
eba00310  Lysine degradation
eba00362  Benzoate degradation
eba00380  Tryptophan metabolism
eba00620  Pyruvate metabolism
eba00630  Glyoxylate and dicarboxylate metabolism
eba00640  Propanoate metabolism
eba00650  Butanoate metabolism
eba00900  Terpenoid backbone biosynthesis
eba01100  Metabolic pathways
eba01110  Biosynthesis of secondary metabolites
eba01120  Microbial metabolism in diverse environments
eba01130  Biosynthesis of antibiotics
eba01200  Carbon metabolism
eba01212  Fatty acid metabolism
eba02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    c1A212 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    c1A212 (fadA)
   00640 Propanoate metabolism
    c1A212 (fadA)
   00650 Butanoate metabolism
    c1A212 (fadA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    c1A212 (fadA)
   00072 Synthesis and degradation of ketone bodies
    c1A212 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    c1A212 (fadA)
   00310 Lysine degradation
    c1A212 (fadA)
   00380 Tryptophan metabolism
    c1A212 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    c1A212 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    c1A212 (fadA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    c1A212 (fadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eba04147]
    c1A212 (fadA)
Enzymes [BR:eba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     c1A212 (fadA)
Exosome [BR:eba04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   c1A212 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAI07410
UniProt: Q5P5K2
Position
complement(1369082..1370362)
Genome map
AA seq 426 aa AA seqDB search
MSPGIYIIDGARTPFLKARNGPGPFAASDLATAAGTALLVRQTFAPDELDEVILGCASPS
PDEVNIGRVVALRLGCGHKVPGWTVMRNCASGMQALDSAMMNIRTGRSGLVLAGGVDALS
RAPLLFSDAMVRWLSGWYAAKTVGRKAAALHSFRPADLAPVLGIMKGLTDPVVGQLMGQT
AENLAHRFGISRAAMDEYAVRSHRRVAAAQDGGHLGEIVPLIDRDGMLYKDDDGVRRDSS
VDKLAKLKPFFDRKYGRVTAGNSSQITDGAAWLILASEEAVQRRGLTPVGRIVDCEWAAL
DPAQMGLGPVHAATPLLARHGLGLNDLDAWEINEAFAAQVIACLCAWDDADYCRDELGLD
APLGRLDEERLNVDGGAIAIGHPVGASGARIVLHLVQRLRRDNLARGIASICIGGGQGGA
MLVETV
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagccccggcatctacatcatcgacggcgcccgcacgccgttcctcaaggcgaggaac
ggccccggaccgttcgccgcgtcggacctcgcgaccgccgccggcacggcgctgctcgtg
cgccagacgttcgcgcccgacgaacttgacgaagtgatcctcggctgcgcaagcccgtcg
ccggacgaagtcaatatcggccgcgtcgtcgcgctgcggctcggctgcggccacaaggtg
ccgggctggaccgtcatgaggaactgcgcgtccggcatgcaggcgctggattcggcgatg
atgaacatccgcaccggccgctcgggcctcgtgctcgcgggcggcgtcgacgcgctatcc
cgcgcgccgctgctgttttccgacgcgatggtgcgctggctgtcgggatggtacgcggcg
aagacggtcggtcggaaagcagctgcgctgcacagcttccgcccggccgatctcgcgccg
gtgctcggcatcatgaaagggctgaccgatccggtcgtcggccagctgatggggcagacg
gcggagaacctcgcgcaccgcttcggcatttcgcgcgccgcgatggacgaatacgcggtg
cgcagccaccgccgcgtcgctgcggcgcaggatggcgggcatctcggcgagatcgtgccg
ctgatcgatcgcgacggcatgctgtacaaggacgacgacggcgtgcggcgcgattcgtcc
gtcgacaagctggccaagctcaagccgttcttcgaccgcaagtacggccgcgtcaccgcc
ggcaacagctcgcagatcaccgatggcgcggcgtggctgatcctcgcgtccgaagaggcg
gtgcagcgccgcggcctgacaccggtcgggcgcatcgtcgattgcgaatgggcagcgctc
gatccggcgcagatggggctcggcccggtgcatgcggcaacaccgctgctcgcgcggcat
ggactcgggctgaacgacctggacgcgtgggagatcaacgaagcgttcgctgcgcaggtc
atcgcgtgcctgtgtgcctgggatgacgccgactactgccgggacgagctcggcctcgac
gctccgctcggccgcctcgacgaggagcgcctgaacgtcgatggtggcgcgatcgccatt
ggccatccggtcggcgcgagtggcgcgcgcatcgtgctgcatctcgtgcagcggctgcgc
cgcgacaatctcgcgcgtggtatcgcgagcatctgcatcggcggcggacagggtggcgcg
atgctcgtggagacggtgtga

DBGET integrated database retrieval system