KEGG   Aromatoleum aromaticum: ebA2395
Entry
ebA2395           CDS       T00222                                 
Name
(GenBank) conserved hypothetical protein
Organism
eba  Aromatoleum aromaticum
SSDB
Motif
Pfam: TraG_N
Other DBs
NCBI-ProteinID: CAI07461
UniProt: Q5P5F1
Position
complement(1429227..1430753)
AA seq 508 aa
MTLYTTDYLEYYLTLVAWVVNNGIWNVLVASGVFALPFVAIVIQEWLRARAEGADEGNKG
VLSSMRIESRVWVAIVVIMFAGIPFIPLDLSTIAFDTSRSAQCQVNVPQPADTGWSNAYT
TLNNQSALAPVWWFFMHAISKAVTGAAVAAIPCGTDLRQIRMDVDATRINDPVLAQEVGD
FVHDCYAPSRAKLFMNRPTLSDEQMNDVTWIGSSYFLNTSGFYDTYHSSTPRTAWPYDAT
RDAGLAQVDNGGGYPTCRQWWSDGSGLRARLLSQVDPDLLSRMGRWAGFLSQIEVNDAVI
RAVVSPRQQQMNQGAVYTDYGGQIEKTLPNVVTRGAGDLGLTVGSLGFFPAMDVVRQALP
MVLSLLKMALVICIPLVLLFGTYELKALVAVSCVEFALFFVDFWFQLARWLDSTILDALY
GWGFGANRPHSNFDPLIGLNNAFGDMLLNFVMATMFIVLPGFWVAALGWVGVRAGNVLSG
LTVATGDAKSAGGSGSRLAISAAKGSGK
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgaccctctatacgacggattacctagagtactacctgaccctggtggcttgggtggtc
aacaacggcatctggaacgtcctcgttgccagcggtgtgttcgccttgcccttcgtcgcc
atcgtcatccaggaatggctccgggcgcgcgcggaaggcgcggacgaaggcaacaagggc
gtactgtcctcgatgcgcatcgagagccgcgtttgggtggcgatcgtcgtcatcatgttc
gccggcatcccgttcattccgttggatctgagcacgatcgcgttcgatacgagccgctct
gcgcaatgccaagtcaatgtgccgcagcccgcggacacgggctggtccaacgcctacacc
accctcaacaaccagagcgcgctggcgccggtgtggtggttcttcatgcacgccatctcg
aaggcggtcaccggggccgcggtggcggcaattccctgcgggaccgatctgcggcagata
cgcatggacgtcgatgccacgcgcatcaacgacccggtgctcgcgcaggaagtcggcgat
ttcgtgcatgactgctacgccccctcgcgcgccaagctgttcatgaaccggccaacgctc
tccgacgagcagatgaacgacgtgacctggatcggttcgagctacttcctcaacacgtcc
ggcttctacgacacctatcattcgagcacgccgcgcaccgcttggccctatgatgcaacg
cgcgacgcgggcctagctcaggtggacaacggtgggggctatccgacctgccgacagtgg
tggtcggacggcagcgggctgcgcgcacgcctgctgtctcaggtcgatcccgatctgctg
tcgcgcatgggccgctgggcgggattcctgtcgcagatcgaggtgaacgatgcggtgatc
cgtgccgtcgtgtcgccgcgccagcagcagatgaaccaaggcgccgtctataccgactac
ggcggccagatcgagaaaacgttgcccaatgttgtgacccgcggcgccggcgacctcggc
ctgaccgtcgggtcgctaggattcttcccggccatggatgtggtccgacaggcgctgccc
atggtgctgtcgctgctcaaaatggcgctcgtcatctgcatcccgctggtgctgctcttc
ggaacctacgagctgaaggccctggtcgcggtgagctgcgtggagttcgcgctgttcttc
gtggatttctggttccagctcgcgcgatggctggacagcacaattctcgacgcactctac
ggctggggattcggagcgaaccggccgcacagcaatttcgaccccttgatcgggctgaac
aatgcctttggggacatgctgctgaatttcgtcatggcgacgatgttcatcgtgctgccg
ggattttgggtggcggcactggggtgggttggtgtgcgggcaggcaatgtgctgagcggc
ctcaccgtcgcaaccggtgacgccaagtcggccggcggaagcggctcccgccttgcgatc
tctgcagccaagggttcaggaaagtag

DBGET integrated database retrieval system