KEGG   Aromatoleum aromaticum: ebA2400
Entry
ebA2400           CDS       T00222                                 

Definition
(GenBank) conserved hypothetical protein
Organism
eba  Aromatoleum aromaticum
SSDB
Motif
Pfam: DUF1525
Other DBs
NCBI-ProteinID: CAI07465
UniProt: Q5P5E7
Position
complement(1433480..1433932)
AA seq 150 aa
MPVPPFRILPALAAWRPMAAAAVTWMCVALFSPLAVADVLVVTDSHHPIKIMGDERVIEL
DLPDRIEAELSAGLPADPGQAEASVQQRLREGKETLQRRIGRAYEGVADAWGLGIAKIPA
VVVDRRYVVYGEPDVARAVARIDAYRSARP
NT seq 453 nt   +upstreamnt  +downstreamnt
atgccggtcccaccctttcgcattcttcctgcccttgctgcgtggcgacccatggctgcc
gcagcggtgacgtggatgtgcgtggccttgttcagcccgcttgcagtagccgacgtgctg
gttgtgactgatagccatcacccgatcaagatcatgggtgacgaacgtgtcatcgaactg
gacctgccggaccggatcgaggccgaactgtctgctggcctgccggccgatccaggccag
gccgaggcaagcgtgcagcagcggttgcgcgaggggaaagagacactgcagcgccggatc
ggccgtgcctacgagggtgtcgccgatgcctggggtctgggcatcgccaagattccggcc
gtggtggtcgaccggcgctacgtggtctacggcgagcccgacgtggcgcgggccgtcgcc
cgtatagatgcctatcggagcgcacggccatga

DBGET integrated database retrieval system