KEGG   Aromatoleum aromaticum: ebA2407
Entry
ebA2407           CDS       T00222                                 
Name
(GenBank) conserved hypothetical protein
Organism
eba  Aromatoleum aromaticum
SSDB
Other DBs
NCBI-ProteinID: CAI07469
UniProt: Q5P5E3
Position
complement(1438476..1438910)
AA seq 144 aa
MHRIWTKTAATLIALMVLGGCATSKDKLLPHGDHTMFDVWNQETGGSAGGGQPARQLLDA
RQGLRRPLTEADVQAVPVTNATYTRTAVNEIHRQFHRLPNPDLVMYVFPHLAGSDPVSVP
GYTTVFPLYQRVQYAMPGERLEDY
NT seq 435 nt   +upstreamnt  +downstreamnt
atgcatcggatctggactaaaacggccgcaacgctgatcgcgctgatggtgttgggcggc
tgcgccaccagcaaggacaagctgctgccgcatggcgatcacaccatgttcgatgtctgg
aaccaggagactggcggcagcgcgggcgggggccagcctgcccggcaactgctcgatgcg
cgccagggcctgcgccggccgctgaccgaggccgacgtgcaggccgtgcccgtgaccaac
gcgacctacacccgcacggcggtcaacgaaatccaccgccagttccaccggctaccgaac
cccgacctggtgatgtacgtgttcccccacctggcaggcagcgatcccgtctccgtgccc
ggctacacgacggtgtttccgctgtaccagcgcgtgcagtacgccatgccgggcgagcgc
ctggaggactattga

DBGET integrated database retrieval system