KEGG   Aromatoleum aromaticum: ebA395
Entry
ebA395            CDS       T00222                                 

Definition
(GenBank) hypothetical protein
Organism
eba  Aromatoleum aromaticum
SSDB
Other DBs
NCBI-ProteinID: CAI06327
UniProt: Q5P8N2
Position
238128..238484
AA seq 118 aa
MTDPMAVVATVHFPREHVRTVRDAVAFLLLRTGFRLESTDLAASALLDMPLPESHRDLGP
YPARAILEVLVGPPYRVQISLVDRTLSIGLTDEGSNAERVAAVRPPLAPQAAALEPLK
NT seq 357 nt   +upstreamnt  +downstreamnt
atgacggatccaatggcggtcgtggccaccgtccattttccccgcgagcacgtgcgcacg
gtgcgcgatgcggttgccttcctgctccttcgcacgggctttcggctcgaatcgacagat
ttggcggcgagtgcgctactcgacatgcccctgccggagtcccatcgcgatcttggcccc
tatcccgcccgggcgatcctcgaggtcctggtcggcccgccttatcgcgtgcagatctcc
ctggtcgatcgcacgctctccattggtctcacggatgaaggcagcaacgccgagcgggtc
gccgccgttcggccgccgctcgcaccgcaggccgcagcgctggagccgctgaagtga

DBGET integrated database retrieval system