KEGG   Aromatoleum aromaticum: ebA3999Help
Entry
ebA3999           CDS       T00222                                 

Gene name
wcaG
Definition
(GenBank) ADP-l-glycero-D-manno-heptose-6-epimerase (ec 5.1.3.20)
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
eba  Aromatoleum aromaticum
Pathway
eba00540  Lipopolysaccharide biosynthesis
eba01100  Metabolic pathways
Module
eba_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:eba00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    ebA3999 (wcaG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:eba01005]
    ebA3999 (wcaG)
Enzymes [BR:eba01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     ebA3999 (wcaG)
Lipopolysaccharide biosynthesis proteins [BR:eba01005]
 Unusual sugar
  ebA3999 (wcaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 BCNT
Motif
Other DBs
NCBI-ProteinID: CAI08393
UniProt: Q5P2S1
Position
complement(2360811..2361770)
Genome map
AA seq 319 aa AA seqDB search
MIIVTGGAGFIGSNIVQGLNARGITDILVVDDLTDGHKCLNLADADIHDYMDKDDFLRRV
EANEDFGPVEAIFHEGACSSTTEWDGRFVMAVNYEYTKSLLGWAVARKVPLLYASSASVY
GMGPTFRESREFEHPLNMYAYSKFLFDCHLRRFAPGIDSQVVGLRYFNVYGPREQHKGSM
ASVAYHFHNQLNDSGRLRLFEGADGYGPGEQQRDFIHVDDVVAVNLWLLDNPGVRGIFNV
GTGRAQSFNEVAHAALSWHKGSTAGGGIDYIAFPEHLRGRYQSYTQADITALRQAGYEGE
FMPVEVGVPRYLEWLALRD
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcgtcacaggcggcgccggcttcatcggcagcaacatcgtgcaggggctcaac
gcccgcggcatcaccgacatcctggtcgtcgacgacctcaccgacgggcacaagtgcctg
aacctcgcggacgccgacatccacgactacatggacaaggacgatttcctgcgccgcgtc
gaggcgaacgaggatttcggaccggtcgaggcgattttccacgaaggcgcatgctcctcg
acgacggagtgggatggccgcttcgtgatggcggtgaactacgaatacacgaagtcgctg
ctcggctgggcggtcgcgcggaaagtgccgttgctgtacgcgtcgtcggcgtcggtctac
ggcatggggccgacgttccgcgaatcgcgcgagttcgagcatccgctgaacatgtacgcc
tactcgaagttcctgttcgactgccatctgcgcaggttcgcgccgggcatcgacagccag
gtcgtcggcctgcgctacttcaacgtctacggcccgcgcgagcagcacaagggcagcatg
gcgagcgtcgcgtaccatttccacaaccagctgaacgacagcggccgcctgcgcctgttc
gaaggcgccgacggctacggcccgggcgagcagcagcgcgacttcatccacgtcgatgac
gtcgtcgcggtgaacctgtggctgctcgacaaccccggggtgcgcggcatcttcaacgtc
ggcaccggccgcgcacagagcttcaacgaagtcgcccatgccgcgctgagctggcacaag
ggcagcaccgccggcggcggcatcgactacatcgcgttcccggaacacctgagaggccgc
taccagagctacacgcaggccgacatcacggcgctgcgccaggcgggctacgagggcgag
ttcatgccggtcgaagtcggcgtgccgcgctacctggaatggctcgcgctgcgcgactga

DBGET integrated database retrieval system