KEGG   Aromatoleum aromaticum: ebA400
Entry
ebA400            CDS       T00222                                 

Definition
(GenBank) hypothetical protein
Organism
eba  Aromatoleum aromaticum
SSDB
Other DBs
NCBI-ProteinID: CAI06330
UniProt: Q5P8M9
Position
239671..240252
AA seq 193 aa
MTPNATRRAFLVQASAALALLAVPSRSHARAQVRKTPPAYPPIPPAYRHVAESLALPAAI
LYGVAIQESVMRWGTVSLPWPWTLNVRAVPRRYGAYETAVADLERILAQGVRNVDCGTMQ
VNWRYHADKLRTPALALEPWHNLKVAGFILLECRATTPSWFDAVGAYHSPGDAERAAPYA
RSVFRHIGRIRDA
NT seq 582 nt   +upstreamnt  +downstreamnt
atgacgcccaatgccacccgccgcgccttcctggtgcaggcctccgcagcgttggcgctg
ctcgccgtaccgtcgcgctcccacgcccgggcgcaggtgcgcaagacgccgcccgcatat
ccgccaatcccgccggcctatcgccacgtcgccgaatcgctcgcgcttcccgccgcgatc
ctgtacggcgtcgcgatccaggagtcggtgatgcgctggggaaccgtctctttgccttgg
ccctggaccctcaatgtgcgcgccgtcccacgccgctacggcgcctatgagacggcggtt
gccgacctggagcgaatcctggcgcagggcgtgcgcaacgtggactgcggaaccatgcag
gtcaactggcgctaccacgccgacaagctccgtacccccgcgctcgcgctggagccctgg
cacaacctgaaggtggccggtttcattctcctcgagtgccgtgcgaccaccccgagctgg
ttcgacgccgtcggcgcctatcacagccccggcgacgccgaacgggctgccccctacgcc
cgatcagtgtttcgccatatcggcaggatccgcgatgcctga

DBGET integrated database retrieval system