KEGG   Aromatoleum aromaticum: ebA403
Entry
ebA403            CDS       T00222                                 

Definition
(GenBank) conserved hypothetical protein
Organism
eba  Aromatoleum aromaticum
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind DUF87 FtsK_SpoIIIE DUF853
Other DBs
NCBI-ProteinID: CAI06331
UniProt: Q5P8M8
Position
240364..242577
AA seq 737 aa
MATLPPGLLPAHPPGHGCAYLFEGLEVSRGAIEAWLRPPIEIWSAAASAGCGLIALVAPW
ALMMPAELGLATASLAFGFAGFRGNQAWRVWRYQYGLTRYKVTAVAPHRLPRIPGKLYLG
EGFAWGQQHTQRRMDATRPHAQAYLVEGPFIRSTRAALRALRSTPLKPLAAALMLPRWWN
PLSEPPDLGGTPVLHGVEPKEVPVTLGQKHRPGHLLVLGTTRVGKTRGMELLATQDIRDG
KVVIVIDPKGDADLMLRVHAEAARAGRLDQLYLFHLGYPDISARYNGIGNFARITEVANR
TTNPLPSSGNSAAFKEFAWRFTNLVAQAQVALGQVPTYDLLLRDITDIEPLFLRYATHVL
QTQGPGNWEVLVEQVQARIEKRQLSVPRTLQDRSERLIALVHVLKDLQLPDAVLQGLATA
VRYERSFFEKIVASLGPFLEKLTTGPVGKLISPDYFDPTDTRPIFDWMQVIRQDGIVYVG
LDALSDATVAAAVGNSMLADLVSVGGKLYKTGLNPHHPTGKIVLPEVACHFDEVNEIAGP
EFVPMVNKLGGSGFSITAYTQTIPDIEARLGDAAKARQVLGNFNNLVMLRVKDPGTAEFF
CNQLPDVDVQHLMVVTGVSDTDGSTETDFTSRNEDRLTTLREPMVSPADIMALPQGQAFA
LLEGNRLFKLRFPLPDPANDRFIPASLQEIAVQMRAKYRTSEHWAGQTDWLKDMPVGLVT
PLGFVDEPADEPGGEAK
NT seq 2214 nt   +upstreamnt  +downstreamnt
gtggccactctcccaccgggcctcctccctgcccaccctcccggccacggttgtgcctac
cttttcgaggggctggaagtgagccgcggagcgatcgaggcctggctccgaccgccaatc
gagatctggagcgcagcggcttcggcagggtgcgggctgatcgcgctggtggccccctgg
gcgctgatgatgccggccgaactgggactcgcgaccgcctccctcgccttcggcttcgcc
ggctttcgcgggaatcaggcctggcgggtctggcgttatcagtacgggctgacgcgctac
aaggtcaccgccgtagcaccccaccggcttccccgcatccccggcaagctctacctgggc
gaaggcttcgcctggggacagcagcatacgcagcggcgcatggatgcgacgcgtccgcac
gcccaggcgtatctggtggagggcccgttcatccgctcgacgcgggcggcgctccgggcc
ctgcgctccacgcccctgaagcccctcgccgcagcgctcatgctgccacgctggtggaac
ccgctctccgagccgccggacctcggcggcacgccggtcctgcacggcgtggagccgaag
gaggtccctgtcacgctcgggcagaaacaccgccccggccacctcctcgtcctcggtacg
acccgcgtcggcaagacgcgcggcatggagctcctagccactcaggacatccgcgacggc
aaggttgtgatcgtcatcgacccgaaaggcgacgcggacctcatgctgcgtgtccatgcc
gaggcggcacgggccggccgcctggaccagctctatctcttccacctcggctacccggac
atctccgcccgctacaacggcattggcaatttcgcccgtatcaccgaggtcgcgaaccgc
accaccaatccgctcccgtccagtggaaactccgccgcattcaaggagttcgcctggcgt
ttcacgaacctcgtcgcccaggcgcaggtggccctgggacaggtcccgacctacgacctg
ctgctgcgcgatatcaccgacatcgaaccgctcttcctgcgctacgccacgcacgtgctc
cagacccagggccccggcaactgggaagtgctggtcgaacaggtacaggcccgtatcgag
aagcggcagctcagcgtgccgcgcaccctgcaggaccgcagcgagcgcctcatcgccttg
gtgcatgtactgaaggacctgcaacttcccgacgccgtcctgcaggggctggccactgcg
gtgcgctacgagcggagcttcttcgagaagatcgtcgcctccctggggccgttcctcgag
aagctcaccaccggccccgttggcaagctcatctccccggactacttcgacccgaccgac
acccggccgatcttcgactggatgcaggtcattcgccaggacggcatcgtgtacgtgggt
ctcgacgccctctccgatgccacggtcgccgcagccgtcggcaattccatgctcgccgac
ctcgtcagtgtcgggggcaagctctacaagaccggcctcaatccgcatcacccgacgggc
aagatcgtcctgcctgaggtggcctgccacttcgacgaggtgaacgagatcgccggtccc
gagttcgtgccgatggtgaacaagctgggcggctccggcttcagcatcaccgcctacacg
cagaccatcccggacatcgaggcccggctcggcgacgccgccaaggcgcgccaggtgctg
ggcaacttcaacaacctggtcatgctgcgggtcaaggaccccggcacggccgagttcttc
tgtaatcagctgcccgacgtcgacgtccagcaccttatggtagtgactggggtcagcgac
acggacggctcaaccgagaccgatttcacctcccggaacgaagaccgtctcaccaccctg
cgcgagccgatggtgtcgcccgccgacatcatggccctgccccaaggccaggccttcgcg
ctcctggaaggcaaccgcctcttcaagcttcgcttcccgctccccgatcccgccaacgac
cgcttcatccccgcttcactgcaggagatcgccgtccagatgcgcgccaagtaccggacg
tccgagcactgggcaggccagacggactggctgaaggacatgccggtcggactggtcacg
ccgctcggctttgttgacgagcctgccgacgagcccggaggggaggccaaatga

DBGET integrated database retrieval system