KEGG   Aromatoleum aromaticum: ebA412
Entry
ebA412            CDS       T00222                                 

Definition
(GenBank) conserved hypothetical protein
Organism
eba  Aromatoleum aromaticum
SSDB
Motif
Pfam: TrbI ARL6IP6 CdiI_2 NRBF2
Other DBs
NCBI-ProteinID: CAI06338
UniProt: Q5P8M1
Position
246753..248204
AA seq 483 aa
MHVSQNKLVPVLTAVALTVTGYILYKQSEHPGVEPGAPMTEVPLPPTQKGADADTPQETL
KTVVAGYSELNDRVAALVDENRRLLEENTRKQRTEDRIREQLRKELRTEMTAEIEALNRR
QAPTADTGGLLESALGPGNLPRGFGFDSGSKAGNTGGTVAAAPTRVLPLGYEMGKGADGK
EGVVRKLALADTTATAARRTRTAPSSQARKTVPAAIPFFTIPENATLTGVANMTAIVGRV
PVDGKVTDPMQFKLLLGPENLAANGHYLPRNLTGVVVSGIAIGDMTLSCAEGLIQSLTFV
FNDGSIETVSRRNNGTTPLFGATDSSSGHMPSLAAAPKLGWISDRYGNPCIPGRFVTNAP
AHLTDAIGLRSLAIAGQAAAAAQTTQTGNVFGTTTSRVTGDTGTYILGQMMGGATDEVTS
WIMRRLTNSFDAVVVPAGGEVVVHIDTEIPIDKSPEARRLDYGRLDTGSARLSQLRGTYH
GLD
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgcatgtcagccagaacaagctggtgcccgtcctcacggccgttgccctgacggtgacg
ggctacatcctctacaaacagagcgagcatccgggcgtcgagccgggcgcgccgatgacg
gaggtgcctctgcctcccacgcagaaaggggccgatgccgatacaccccaggagaccctc
aagaccgtcgtggcgggctacagcgaactcaacgatcgcgtggcggcgctggtggatgag
aaccggcgcctgctcgaggagaacacgcgcaagcagcgcaccgaggaccggatccgtgag
caactccgcaaggagcttcggaccgagatgacggccgagattgaggccctgaaccgccgc
caggcgcccacagcagataccggcggactcctcgaatcggcgctcggccccggtaacctc
ccccgtggtttcggtttcgacagcggctcgaaggctggcaataccggcgggacggtcgcg
gcggcgcccacccgcgtgctgccgctgggttacgagatgggcaagggagcggacggcaag
gagggcgtcgttcgcaagctggcactggcagacaccacggccacggccgccaggcgcact
cggaccgcgccctcctcccaggcacgcaagacggttcccgccgctatccccttcttcacc
atccccgagaacgcgacgctcaccggtgtcgccaacatgacggcgatcgtcggccgggtg
ccggtggacgggaaggtaaccgatcccatgcagttcaagctgctcctgggcccggagaac
ctggccgcaaacggtcactacctgccgcgaaacctcacgggcgtggtcgtctccggcatc
gccatcggcgacatgaccctttcctgcgccgagggtctcatccagtcgctcaccttcgtg
ttcaatgacgggagcatcgagacggtgagccgccgcaataacggcaccacccctctgttc
ggcgccaccgatagctcaagcggccacatgccgtcgctcgctgcggcgccgaagctcgga
tggatctccgaccgatacggcaacccctgcattccgggacgattcgtcacgaacgcgccc
gctcatctcaccgatgcgatcgggctgcggagcctggcgatcgcgggccaggccgcggcg
gctgcgcaaaccacccagacgggcaacgtgttcgggacaacgacgagccgcgtcaccggc
gacacgggaacctacatcctgggccagatgatgggcggcgccaccgacgaagtgacgagc
tggatcatgcggcggctgaccaactccttcgacgccgtggtcgttcccgccggcggggag
gtcgtggtgcacatcgacactgagatcccgatcgacaaatcccccgaagcccgccggctc
gactacgggcgcctggacaccggctccgcgcgactttcccaactcagaggcacctaccat
ggactcgactga

DBGET integrated database retrieval system