KEGG   Aromatoleum aromaticum: ebA415
Entry
ebA415            CDS       T00222                                 

Definition
(GenBank) hypothetical protein
Organism
eba  Aromatoleum aromaticum
SSDB
Other DBs
NCBI-ProteinID: CAI06339
UniProt: Q5P8M0
Position
248191..248664
AA seq 157 aa
MDSTDPTCRIVLPLLAAITVTACSVAGPRSSPLPAEGPTMEQIYRDRTGEADRNRAREAL
PLRPAEEIRPGPVRESALQQIEQRFARLENPDLIMVVFPHLAHGKYPVPAYVTAFPMYES
VEYLLPGEGDGPPRPETPSVPSALGGSETTVRAPGGN
NT seq 474 nt   +upstreamnt  +downstreamnt
atggactcgactgacccgacctgccgaatcgtcttgccgctcctggctgccattaccgtc
acagcatgcagcgtcgccgggccgcgctcctcgcccctgcccgcggaggggccgaccatg
gagcagatctaccgggatcgcaccggcgaagccgaccgtaaccgcgcacgggaagcgctg
ccgctgcgcccggcggaggagatccgccccgggcccgtgcgcgagtcggccctgcagcag
atcgagcagcgcttcgcgcggctcgagaacccggatctcatcatggttgtcttcccgcac
ctcgcccacggcaagtatccggtgcccgcgtatgtgaccgccttccccatgtacgagtcg
gtggagtacctgctccccggagagggcgacggcccgccccgtccagagacgcccagcgtg
ccttcggcactgggcgggagcgaaacgaccgtccgtgccccgggcggcaattag

DBGET integrated database retrieval system