KEGG   Aromatoleum aromaticum: ebA416Help
Entry
ebA416            CDS       T00222                                 

Definition
(GenBank) conserved hypothetical protein
Organism
eba  Aromatoleum aromaticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraC_F_IV AAA_10 FtsK_SpoIIIE
Motif
Other DBs
NCBI-ProteinID: CAI06340
UniProt: Q5P8L9
Position
248678..251530
Genome map
AA seq 950 aa AA seqDB search
MFGFTRMLGFGPSHDDPTSTGASRSGEPIVPRQPFRIRDRRRFAARPPSITDQLPWVDYE
PETNTFLLEDGVSRALLFELEPIATEASTDQYLQARCVEIQSALQALPEYDEAPWVVQFF
CNDDTDLSWQIERLRDYILSVHEKAPERARAILESDFTRHFFGEMAEHLAQVSRPEGLFT
DEGVSGNRWRGQLRRVRCAIYRRFPEGFDFSREVLDPVEKLQQTARGLIAGLGQTGVKAR
PMNAADFYAWLLPFFNPKPDFAATAGELLRLCTYPTEDVAAEGLDLAELLFLSPPRSDHK
AGLWFFDGRPVRALALQSVSKRPEIGHFTAEREHAGKHFARFERLPDGTMLSATMVIYPQ
DTMRRRVEGIKSASRANTIDAIHTHDEAVQVLDHMRADKLYPLYLVLFVRGEDVKQLGRQ
VADLTAVLHTSGLKLIQPTDELQGCDVFLRALPMCFDPAYDGKQLRRSRLIFASQIAALL
PLYGRARGTGHPGFWLWNRGGEPFLFDPLNPRDRNKNAHLLTLGPTGAGKSATLCYLAML
VMAIYRPRLFIVDAGNSFGLLGEHLRAHGLTVHRVELTPDADLSLPPFVMAPRLFEQEEE
KALARAMESPELEALPSDNSEPPRKVKDDDDEEGADPGKRDVLGEMIIAATLMITGGEEG
EMRKMSRADRYLIARAILTAAHRARDEGKPHPRAQDVAQTLMAMRNDESLGLARRDRAEE
MGQAMMVFCDGLRGRLFDRYGMNWPDVDVTIVEMGTLAHEGYEDALAVAYTSLVNHVQAL
AEATQHDHRPIVNLTDEGHIVTINELLNVYVVKITKMWRKLGAWFWLGTQNMKDFPESAS
RMLNMCEHWMLLTMDRDEIEQVGRFRTLTAEQRALMESARKEPPKYTEGVILNPKMQALF
RNVPPPLAIALAMTEKHEKAQRQDIMTATGCTELEAAYAIARELAAKRAA
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atgttcggcttcacccgcatgctgggctttggcccgagccacgacgatccaacgagcacg
ggtgcgtcccggtccggcgagcccatcgtgccccgccagcccttccggatccgcgaccgg
cgccgcttcgcggcgcgtccgcccagcatcaccgatcagttgccctgggtggactacgag
ccggagacgaacaccttcctcttggaggatggtgtctcccgcgccctcctcttcgagctc
gagcccattgccaccgaggccagcaccgaccagtacctgcaggcgcgctgcgtcgagatc
cagtcagcgctgcaggcgctgccggaatacgacgaggcgccctgggtggtgcagttcttc
tgcaacgacgacacggatctctcctggcagatcgagcgccttcgggattacatcctctcg
gtgcatgagaaagccccggaacgcgcccgcgccatcctggagagcgacttcacccggcat
tttttcggcgagatggccgaacacttggcccaggtgtcgcgaccggaagggctcttcacc
gacgaaggcgtatcgggcaaccgctggcgcggccaactgcggcgggtgcgctgcgcgatc
tatcgccgctttcccgagggctttgacttctcgcgggaagtcctcgaccccgtcgagaag
ctccagcagacggcccggggcctgatcgccgggctcggccagacgggcgtcaaggcccgg
cccatgaacgccgcggacttctacgcgtggctgctgccctttttcaatcccaagccggac
ttcgcggccacggccggggagttgctgcgcctgtgcacctaccccaccgaggatgtggca
gcggaggggctggacctcgcggaactcctcttcctctccccgccgcgctcggatcacaag
gccgggctgtggttcttcgacgggcgcccggtgcgcgccctggcgctccagtccgtatcg
aagaggccggagatcggtcatttcaccgcggaacgcgagcacgccggcaagcacttcgca
cgcttcgagcggctccccgacggaaccatgctctccgcgaccatggtgatctacccgcag
gacaccatgcgccggcgggtcgagggcatcaagagcgcttcacgcgccaacacgatcgac
gcgatccacacccatgacgaggccgtccaggtcctcgaccacatgcgcgccgacaagctc
taccccttgtacctcgtgctcttcgtgcgaggcgaggacgtaaagcagctgggccgccag
gtggccgatctcaccgccgtgctgcacacctcgggcctcaagctgatccagcccaccgac
gagttgcagggctgcgacgtctttctgcgcgcgctcccgatgtgcttcgaccctgcctat
gacgggaagcagctccgccgcagccggttgatcttcgcctcccagatcgccgccttgctg
cccctctacggccgtgcccgcgggaccgggcatccgggcttctggctgtggaaccggggc
ggtgagcccttcctctttgatccgctgaacccccgcgatcgcaacaagaatgcccacttg
ctcacgctgggcccgacgggagccggcaagtcggccaccctctgctacctcgcgatgctg
gtgatggccatctaccgcccgcggcttttcatcgtcgatgcgggaaattccttcggcttg
ctgggcgagcacctgcgcgcccacggcctcactgtccatcgggtggagctcacccccgac
gcggacctgtcgctgccgcccttcgtcatggcgcctcggctcttcgaacaggaggaagag
aaggcgctggcgcgcgccatggaatcgcccgagctcgaagcgcttccatctgacaactcg
gagccaccacggaaggtgaaggatgacgacgatgaagaaggcgccgatcccggcaaacgg
gatgtcctgggcgaaatgatcatcgcggccaccctgatgatcaccggaggcgaggaaggc
gagatgcgcaagatgagccgtgccgaccgctacctgatcgcgcgcgccatcctgaccgcg
gcgcaccgtgcacgcgatgagggaaagccccatccacgggcccaggacgtggcccagacg
ctcatggccatgcgcaacgacgagagcctcgggctcgcccgccgcgatcgcgccgaggag
atgggccaggcgatgatggtcttctgcgacggtctgcgcgggcgtctcttcgaccgctat
ggcatgaattggccggacgtcgacgtgaccatcgtcgagatgggcaccctggcccacgag
ggctacgaggacgcccttgccgtcgcctacacctcgctcgtgaaccacgtccaggccctg
gcggaagccacccagcacgaccatcgacccatcgtgaatctgaccgacgagggccacatc
gtgacgatcaacgagctcctcaacgtctatgtcgtcaagatcacgaagatgtggcgcaag
ctcggcgcgtggttctggctgggaacgcagaacatgaaggactttccggagagcgcctca
cgcatgttgaacatgtgcgagcactggatgctgctcacgatggaccgggacgagatcgag
caggtcggccgcttccgcaccctcaccgctgaacagcgcgccctgatggaatcggcgcgc
aaggagccgccgaagtacaccgagggcgtcatcctgaatccgaagatgcaggccctcttc
cgcaacgttccgccgcccctcgccatcgcgctggcaatgacggagaagcacgagaaggcg
cagcgacaggacatcatgaccgccaccgggtgcacggagctcgaggcagcctatgcgatc
gcccgcgagcttgcggcaaagagggccgcgtga

DBGET integrated database retrieval system