KEGG   Aromatoleum aromaticum: ebA584Help
Entry
ebA584            CDS       T00222                                 

Gene name
glk
Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
eba  Aromatoleum aromaticum
Pathway
eba00010  Glycolysis / Gluconeogenesis
eba00052  Galactose metabolism
eba00500  Starch and sucrose metabolism
eba00520  Amino sugar and nucleotide sugar metabolism
eba00521  Streptomycin biosynthesis
eba01100  Metabolic pathways
eba01110  Biosynthesis of secondary metabolites
eba01120  Microbial metabolism in diverse environments
eba01130  Biosynthesis of antibiotics
eba01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ebA584 (glk)
   00052 Galactose metabolism
    ebA584 (glk)
   00500 Starch and sucrose metabolism
    ebA584 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    ebA584 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ebA584 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ebA584 (glk)
Enzymes [BR:eba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ebA584 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: CAI06425
UniProt: Q5P8D4
Position
343065..344060
Genome map
AA seq 331 aa AA seqDB search
MPTGCSDTYPRLIGDIGGTHARFAVIDSPGSPPTRFRTLCCDDHAGLLEAVQAYLLLERG
LAGPRVAAFGIANPVEGDRVRMTNHDWSFSIEQLRIELGLARLVVLNDFTALALSLPRLQ
AGERRQIGGGNECAGRPVALIGPGTGLGVSGLVRCGNGYAPLEGEGGHVTLAASTPREAE
LIAVLAARFDHVSAERALSGPGLIALHDAIRQLAGAPPLALEADEISARAMAASCPWCAE
ALQVFCGMLGSVAGDLALTLGAFGGVYIGGGIVPKLGDFFDRSDFRRRFEQKGRFSEYLA
RIPCYVILAEYPALLGAATALDNALAGETGT
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcccactggctgctccgacacctacccccggctgatcggcgacatcggcggcacgcac
gcccgctttgccgtcatcgactcgccgggcagcccgccgacgcgctttcgcacgctgtgc
tgtgacgatcacgccggactcctggaggccgtccaggcttacctgctgctggaacgggga
cttgccgggccgcgtgtcgccgcgttcggcatcgcgaatcccgtcgagggcgatcgggta
cggatgacgaatcacgactggtcgttttcgatcgagcagctgcgcatcgagctcgggctc
gcgcggctcgtggtcctcaacgacttcaccgcgctcgcgctgtcgctgccccgactgcag
gccggtgaacggcgtcagatcggcggcggcaacgagtgcgccgggcggccggtcgcgctg
atcggaccgggcaccggtctcggcgtgtcggggctggtgcgctgcggcaacggctacgcg
ccgctcgaaggcgaaggcggccacgtcacgctggcggcgtccacgccacgcgaagcggag
ctcatcgcagtgctcgccgcgcgcttcgaccacgtgtcggccgagcgggcgctgtcggga
ccggggctgatcgccctgcacgacgcgatccggcagctcgcgggcgccccgccgctggcc
ctcgaagcggacgagatcagcgcccgggcgatggccgcgagctgtccatggtgcgccgag
gcgctgcaggtcttctgcgggatgctcggcagcgtcgccggcgacctcgcgctgacgctg
ggcgcattcggcggcgtgtatatcggggggggaatcgtgccgaagctcggcgacttcttc
gatcgatcggatttccgccggcgcttcgaacagaaaggacggttttccgaatacctcgcg
cgcatcccctgttacgtcatcctcgccgaatatcctgcgctgctcggcgccgcgacggcg
ctcgacaacgcgctcgccggcgaaacgggcacctga

DBGET integrated database retrieval system