KEGG   Aromatoleum aromaticum: ebA6176Help
Entry
ebA6176           CDS       T00222                                 

Definition
(GenBank) Phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
eba  Aromatoleum aromaticum
Brite
KEGG Orthology (KO) [BR:eba00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    ebA6176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 GtrA
Motif
Other DBs
NCBI-ProteinID: CAI09653
UniProt: Q5NZ61
Position
3659930..3661513
Genome map
AA seq 527 aa AA seqDB search
MEFQHISEIERATRKGRAELFRLGTGLIFIVGGMLYAAMIGQGEGGVMLAAAAAVGCYMA
MNIGANDVANNVGPAVGSKALTLGGALVIAAIFEAAGALIAGGEVVNTIRSGIIDPARIS
DPDTFVWVMMSALLAGALWLNIATAVGAPVSTTHSIVGAVLGAGIAASGMEIANWGEVGR
IVVSWVVSPLMGGIVAAAFLYLIKRSITYQHDMVAAATRMVPYLVALMAWAFGTYLMLKG
LKQLWKVDFLTAVLIGFGFAVAVLFLVRPLVARRAQSIANSKQSVNRLFTAPLIFAAALL
SFAHGSNDVANAVGPLAAIVDVLASGATEISRSAPIPLWVMLMGALGISVGLALFGPKVI
KTVGSEITELDQMRAYCIAMAATITVIIASQLGLPVSSTHIAVGGVFGVGFLREYLKSNY
ARMVADIKAHHPEGDQAAIDAFLARFAVAPIDEKGQMLRELKAKAKQRLDPAHFSKMERK
GLRKVYRKELVKRSQLMRIAAAWVITVPASALMAGLLFFMMRGMMLG
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
gtggagtttcaacacatcagcgagatcgagcgggcgacccggaaaggccgggcggagctg
tttcgtctcggaacaggcctgattttcatcgtcggcgggatgttgtacgccgcgatgatc
ggacagggcgaaggtggcgtcatgctggctgcggcagccgcggtcggctgctacatggcg
atgaacatcggcgccaacgacgtcgcgaacaacgtcgggccggcagtcggatcgaaggcg
ctgacgctgggcggcgcgctcgtgatcgcggcgatcttcgaggcggctggcgcgctgatc
gccggtggcgaagtggtcaatacgatacgcagcggaatcatcgacccggccaggatctcg
gacccggatactttcgtctgggtcatgatgtcggcgctgctcgccggcgcgttgtggctc
aacattgcgaccgcagtcggcgcgccggtgtcgacgacccactcgatcgtcggcgcggtg
ctcggcgccggcatcgcggcgagcggaatggagatcgccaactggggcgaggtggggcgg
atcgtcgtcagctgggtggtctcgccgctgatgggcggaatcgtcgcggcggcgtttctc
tacctgatcaagcgcagcatcacgtaccagcacgacatggtcgcggccgctacccgcatg
gtgccgtacctggtcgcgctgatggcgtgggcgttcggcacctatttgatgctgaaagga
ttgaagcagctgtggaaggtcgatttcctgaccgctgtgctgatcggcttcggctttgcc
gttgcggtgctgttcctggtccggccgctcgtcgcccgccgtgcacagtcgattgcgaac
tcgaagcagagtgtgaaccggcttttcactgcgccgctgatctttgccgctgcgctgttg
agcttcgcccatggctcgaacgacgttgcgaacgcggtcggcccgctcgcggcgatcgtt
gacgtcctcgcctccggtgcaaccgagatttcgcgctcggcgccgattccgctgtgggtg
atgttgatgggggcgctgggtatctcggtcggcctcgcgctgttcggtccgaaagtcatc
aagaccgtgggctcggaaatcaccgagctcgaccagatgcgtgcgtactgcatcgcgatg
gcggcgacgatcacggtgatcatcgcgagtcagctcgggctgccggtgagttccacgcat
atcgcggtgggcggcgtgttcggcgtgggcttcctgcgcgagtacctgaagagcaactat
gcgcgcatggttgccgacatcaaggcgcatcaccccgaaggcgaccaggccgccatcgat
gcgttcctcgccaggttcgcagtcgcgccgatcgacgagaagggccagatgctgcgcgaa
ctgaaggccaaggccaagcagcgactcgatcctgcccacttctcgaagatggagcgcaag
ggcctgcgcaaggtgtatcgcaaggagctggtcaagcgctcgcagctgatgcgcatcgcc
gccgcctgggtaatcaccgtccccgcgtcggcgctaatggcggggctcctgttcttcatg
atgcgcggcatgatgctcggctga

DBGET integrated database retrieval system