KEGG   Aromatoleum aromaticum: ebA6684Help
Entry
ebA6684           CDS       T00222                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase complex, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
eba  Aromatoleum aromaticum
Pathway
eba00020  Citrate cycle (TCA cycle)
eba00310  Lysine degradation
eba01100  Metabolic pathways
eba01110  Biosynthesis of secondary metabolites
eba01120  Microbial metabolism in diverse environments
eba01130  Biosynthesis of antibiotics
eba01200  Carbon metabolism
Module
eba_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eba_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eba00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ebA6684 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    ebA6684 (sucB)
Enzymes [BR:eba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ebA6684 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: CAI09945
UniProt: Q5NYB9
Position
complement(3967150..3968334)
Genome map
AA seq 394 aa AA seqDB search
MLIEVKVPQLSESVSEATLVSWHKKEGDAVSRDENLIDIETDKVVLETPAPADGVLVKIV
KADGENVTSGDLIAQIDTEAKAPAGAKPAEAVQAVAAPAPAVAAATTGGAPSPAARKILE
EKGVAAGDVSGTGRGGRVTKEDAVAAQPRAAAPVAAAVRGGDRAEERVPMTRLRARIAER
LIQSKNENAILTTFNEVNMAPVMALRKQYGEKFEKAHGVRLGFMGFFVKAAVAALKKYPI
INASVDGNDIVYHGYIDIGIAVGSPRGLVVPIIRDADQMSIADIEKKIAEYGQKAKDGKL
SLEELTGGTFSISNGGVFGSMLSTPIINPPQSAILGIHATKDRPVVENGQIVIRPINYLA
LSYDHRIIDGREAVLGLVAMKEALEDPARLILDV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgctgattgaagtgaaagtgccgcaactgtcggaatccgtatccgaagccacgctggta
tcgtggcacaagaaggaaggcgacgcggtgtcgcgcgacgagaacctcatcgatatcgaa
accgacaaggtcgtgctggaaaccccggcaccggccgatggcgtgctggtgaagatcgtc
aaggccgacggcgagaacgtgaccagcggcgacctgatcgcccagatcgacaccgaagcg
aaagcgccggccggggccaagcccgccgaggcggtccaggccgtggccgcgccggccccg
gcagtggcggcggcgacaaccggcggagcgccgagccccgctgcacgcaagatcctcgag
gagaagggcgtcgctgccggcgacgtttccggcaccggccgcggcggtcgcgtcacgaag
gaagacgcggttgccgcccagccgcgcgctgctgcgccggtcgcggcggcagttcgaggt
ggcgatcgggccgaagagcgcgtaccgatgacgcgcctgcgcgcgcgcatcgccgagcgc
ctgatccagtcgaagaacgaaaacgcgatcctgacgacgttcaacgaagtcaacatggcg
ccggtgatggcgctgcgcaagcagtacggcgagaagttcgagaaggcgcacggcgtgcgc
ctgggcttcatgggtttcttcgtcaaggccgcggtcgccgcgctgaagaaatatccgatc
atcaacgcgtcggtcgatggcaacgacatcgtctatcacggctacatcgacatcggcatc
gccgtcggcagcccccgcggtctcgtcgtgccgatcattcgtgacgccgaccagatgtcg
atcgccgacatcgagaagaagatcgccgagtacggccagaaggcgaaggacggcaagctg
tcgctcgaagagctcaccggcggcacgttctcgatctcgaacggcggggtgttcggctcg
atgctgtcgacgccgatcatcaacccgccgcagtccgcgatcctcggcatccacgccacc
aaggaccgtccggtcgtcgagaacggccagatcgtcatccgcccgatcaactacctggcg
ctgtcctacgaccaccgcatcatcgacggccgcgaagcggtgctcggcctggtggcgatg
aaggaagcgctggaagatccggcgcgcctgatcctcgacgtctga

DBGET integrated database retrieval system