KEGG   Aromatoleum aromaticum: ebA832Help
Entry
ebA832            CDS       T00222                                 

Gene name
icd2
Definition
(GenBank) Isocitrate dehydrogenase isozyme 2,monomeric type, NADP-specific
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
eba  Aromatoleum aromaticum
Pathway
eba00020  Citrate cycle (TCA cycle)
eba00480  Glutathione metabolism
eba01100  Metabolic pathways
eba01110  Biosynthesis of secondary metabolites
eba01120  Microbial metabolism in diverse environments
eba01130  Biosynthesis of antibiotics
eba01200  Carbon metabolism
eba01210  2-Oxocarboxylic acid metabolism
eba01230  Biosynthesis of amino acids
Module
eba_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eba_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:eba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ebA832 (icd2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ebA832 (icd2)
Enzymes [BR:eba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ebA832 (icd2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH B12-binding_2
Motif
Other DBs
NCBI-ProteinID: CAI06558
UniProt: Q5P803
Position
complement(482199..484436)
Genome map
AA seq 745 aa AA seqDB search
MTTKSPTIIYTLTDEAPLLATYSLLPIIETFAQPAGINIAKSDISVAARILAEFSDYLTD
AQKVPDNLAELGRLTQDPDTNIIKLPNISAAVQQLTTAIAELQQKGYAIPNYPETPKTDE
EKIIKQRYGKALGSAVNPVLREGNSDRRAPAAVKRYARKHPHSMGEWSMASRTHVAHMKS
GDFYHGEKSMTLDRARDVKMDLITNSGKTIVLKPKVALLDGEIIDSMFMSKNALCAFYEE
QMEDARKTGVMFSLHVKATMMKVSHPIVFGHAVKIFYKEAFEKHGKLFDELGVNVNNGMS
NLYEKIAPLPESKRDEIVRDLHACHEHRPELAMVDSAKGITNLHAPNDVIVDASMPAMIR
IGGKMWGADGKPKDTKAVMPESTFARIYQEMINFCKTNGNFDPRTMGTVPNVGLMAQQAE
EYGSHDKTFEIPEAGEARIVDIATGEVLLVQNVEEGDIWRMCQAKDAAIRDWVKLAVNRA
RNSGMPTLFWLDPYRPHEAELIKKVETYLKDHDTTGLDIQIMSQVRAMRYTLERVIRGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEEN
HLRWDSLGEFLALTASLEDMGIKTGNDKAKLLARTLDEATGKLLDNDKSPSRKTGELDNR
GSHFYLALYWAQALAAQDDDAELKSRFAPMAKALAENEQKIVDELHAPQGRPADIGGYYL
PDPAKTRAVMRPSATFNAILAEASA
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgaagagtccgaccatcatctacacgctcacagatgaggcgccgctgctggcg
acctactcgctgctgccgatcatcgagacgtttgcccagcctgcgggcatcaatatcgcg
aagagcgacatctcggtggccgctcgtatccttgccgagttttcggactacctgaccgac
gcgcagaaggtgcccgacaacctcgccgaactcggccggctgacgcaggatccggacacc
aacatcatcaagcttcccaacatcagcgccgcagtgcagcagctcaccactgccattgcc
gagttgcagcagaagggttacgcgattccgaactacccggaaacgccgaaaaccgacgaa
gaaaagattatcaagcagcgctatggcaaggcactcggcagtgcggtcaatccggtgctg
cgcgaaggcaactccgaccgccgcgccccggccgcagtcaagcgctatgcgcgcaagcat
ccgcactcgatgggcgagtggagcatggcgtcgcgcacccacgttgcacacatgaagagc
ggcgacttctaccatggcgagaagtcgatgacgctggatcgcgcgcgcgacgtgaagatg
gatctgatcacgaatagcggcaagacgatcgtgctcaagccgaaggtcgcgctgctcgac
ggcgaaatcatcgacagcatgttcatgagcaagaacgcgctgtgcgcgttctacgaagag
cagatggaagacgcacgcaagaccggcgtgatgttttcgctgcacgtcaaggcgacgatg
atgaaggtctcgcatccgatcgtgttcggtcacgcggtcaagatcttctacaaggaggcc
ttcgagaagcacggcaagctcttcgatgagctgggcgtcaacgtcaacaacggcatgtcg
aatctctacgagaaaatcgccccgctgccggaatcgaagcgtgacgagatcgtgcgcgac
ctgcacgcctgccacgagcaccgcccggaactggcgatggtcgactcggccaagggcatt
accaacctgcacgcccccaacgacgtgatcgtcgacgcttcgatgccggcgatgatccgc
atcggcggcaagatgtggggtgccgacggcaagccgaaggacaccaaggccgtcatgccg
gagagcaccttcgcccggatctaccaggagatgatcaacttctgcaagaccaacggcaat
ttcgatccgaggacgatggggactgtcccgaacgtcggcctgatggctcagcaggccgag
gaatacggttcgcacgacaagactttcgagattccggaggccggcgaggcgcgtatcgtc
gatattgccaccggcgaagtgctgctcgtgcagaacgtcgaggaaggcgacatctggcgc
atgtgccaggccaaggacgccgcgatccgcgactgggtcaagctggccgtcaaccgtgcc
cgcaactccggcatgccgaccctgttctggctggatccttatcgtccgcacgaggcggag
ctgatcaagaaggtcgagacctatctcaaggatcacgacacgaccgggctcgacatccag
atcatgtcgcaggtgcgggcgatgcgttacacgctcgaacgcgtcatccgcggcctcgac
accatctcggtgaccggcaacatcctgcgcgactacctgaccgacctgttcccgatcatg
gaactgggcaccagcgcgaagatgctgtcgatcgtgccgctgatggccggtggcgggatg
tacgaaaccggagcgggcggctcggcgccgaagcacgtgcagcagcttgtcgaggagaac
cacctgcgctgggattcgctcggggagtttctcgcgctgacggcgtcgctcgaggacatg
ggcatcaagaccggcaacgacaaggccaagctgctcgccaggaccctcgacgaggcgacc
ggaaaactgctcgacaacgacaagtcgccgtcgcgcaagaccggtgagctggacaaccgt
ggcagccacttctaccttgcactgtactgggcacaggcgctggccgcgcaggacgacgat
gcggagctgaagtcccgtttcgcgccgatggcgaaggcgctggccgaaaacgagcagaag
atcgtggacgaactgcatgcaccccagggacgtccggccgatatcggcggttactacctg
cccgatccggcgaagacccgcgcggtgatgcgcccgagcgccacgttcaatgcgattctg
gcggaagcctccgcctga

DBGET integrated database retrieval system