KEGG   Aromatoleum aromaticum: p2B10
Entry
p2B10             CDS       T00222                                 
Symbol
trbK
Name
(GenBank) entry exclusion protein TrbK; DNA transfer system
Organism
eba  Aromatoleum aromaticum
SSDB
Other DBs
NCBI-ProteinID: CAI10547
UniProt: Q5NWL7
Position
p2:21329..21559
AA seq 76 aa
MNRNLTLTAAALVGALVTGCAPDASEEPKKEEMPVVNDENCKLENIKKIQDDKVRQAFAD
ACARRGDFKSSSGKTY
NT seq 231 nt   +upstreamnt  +downstreamnt
atgaatcgcaatttgaccctgacagcggccgcccttgtgggggccctcgtgactggatgc
gcgccggatgcctcggaagaaccgaagaaggaggaaatgccggtggttaacgatgagaac
tgcaagctggagaacatcaagaagatccaggacgacaaagtacggcaggcgtttgccgat
gcctgcgctcgtcgtggcgacttcaagtctagctccggaaagacctattga

DBGET integrated database retrieval system