KEGG   Aromatoleum aromaticum: p2B11
Entry
p2B11             CDS       T00222                                 
Symbol
trbL
Name
(GenBank) TrbL protein of DNA transfer system
  KO
K07344  type IV secretion system protein TrbL
Organism
eba  Aromatoleum aromaticum
Pathway
eba02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:eba00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    p2B11 (trbL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eba02044]
    p2B11 (trbL)
Secretion system [BR:eba02044]
 Type IV secretion system
  Trb secretion system protein
   p2B11 (trbL)
SSDB
Motif
Pfam: TrbL
Other DBs
NCBI-ProteinID: CAI10548
UniProt: Q5NWL6
Position
p2:21570..23216
AA seq 548 aa
MRLPVTFKALSMLLPLWLALFALDAHAAIDNADVLDSVLTRYQTAASGWAATIINSASWL
FWLLVVISMVWTFGMMALRKADIGEFFAEFVRFTIFTGFFWWLLTNGPNFAKSIMDSLRQ
IGGNATGLGIGLSPSGIVDVGFEIFDKVIDQSSLWSPVNSAVGISIAAAILVILALVGVN
MLLLLVSGWILAYAGIFFLGFGGSRWTSDMAINYYKTVLGVAAQLLAMVLIVGIGKTFLD
GYYGRMSESMTIKEMGVMLIVSVILLSLVNKLPSLVSGIIIGASVGHAGIGNFGAGAAVG
AAGMAAAAAATGGAMLAVGAANAAGGAQAVMAAFSKASENVQSGADAFTSMWAGGGPGGG
GGSGKGEESTGSTPFAQAAGFASSGSVQALRGSSAARAEGQDWDAKGKEEGKSDQGQGKA
SESKANAGTGGAGKAEGGPQRSSGGLRPSAGKAGLFAADAAANLAKGTAQVAKEKMAGIR
DAAMDRIAETTGGKIAAAIKAGSAKDEAGSAIESMPTFGGNNLAGASTSDVDTAAEVAAF
ANRATKFV
NT seq 1647 nt   +upstreamnt  +downstreamnt
atgagactgccagtcaccttcaaagccctttctatgctgttgccgctgtggctggcactc
tttgcgctggatgcccatgccgccatcgacaacgcggacgtgctcgatagcgtactgacg
cgctaccagacagccgcgagcggctgggctgccaccatcatcaattccgcgtcctggttg
ttctggctgttagtcgtgatctcgatggtttggacgttcggcatgatggccttgcgcaag
gccgacattggggagttcttcgcggagttcgtccgcttcacgatcttcaccggcttcttc
tggtggcttttgaccaacggcccgaacttcgccaaatcgatcatggatagcttgcggcag
atcggcggcaatgcaactggactcggcatcggcctttccccatccgggatcgtggatgtg
ggttttgagatcttcgacaaggtaatcgaccaatcgtcgctgtggtcgccagtgaatagc
gccgtagggatcagcatcgccgcagccatcttggtgattctcgctctagtcggcgtcaac
atgctgctactgctggtctccggctggattctggcgtatgcgggaatcttcttcctaggc
ttcggcggctcccggtggacctccgacatggcgatcaactactacaagaccgtcctcggc
gtggcggctcaactgctcgcgatggtgctgatcgtcggcatcggtaaaaccttcctcgat
ggctactacggaaggatgagcgaaagcatgaccatcaaggaaatgggggtcatgttgatt
gtttccgtaatcctgctatcgctggtcaacaagctcccaagcctcgtatccggaatcatc
atcggcgccagtgtcgggcacgccggcattggcaacttcggagctggcgctgcggtcggc
gccgcgggcatggcggcagcagcagcggcgacgggaggcgcgatgttggctgtaggtgcc
gcgaacgcggccggtggtgcacaagccgtgatggcggccttctccaaggccagtgagaac
gtccaatccggcgctgacgcattcaccagcatgtgggccggtggcggcccgggagggggc
ggaggcagcggcaagggtgaggaaagcaccggcagcacgccattcgcacaggcggccggc
ttcgcatcatccggcagcgtccaagccctacgcggcagttcggcagcgagggccgagggg
caggattgggacgccaagggcaaagaagaagggaagtccgatcaggggcaaggcaaggct
agcgagtccaaggccaacgcaggaacgggcggcgccggaaaggcagaaggagggccgcag
cgaagctccggaggcttgaggccctcggccgggaaagcggggctgttcgccgccgatgca
gccgcgaacttggcgaaaggcacggcacaggtagcaaaggaaaagatggcgggcatcagg
gatgccgcgatggatcgcatcgccgaaaccacggggggcaagatcgccgccgccatcaag
gccgggagtgcaaaagacgaggcaggaagcgccatcgaatcgatgccgacgtttggaggg
aacaacctcgcgggcgccagcaccagcgatgtcgacacggcggcagaagtcgctgcattt
gccaaccgagccaccaagttcgtatga

DBGET integrated database retrieval system