KEGG   Aromatoleum aromaticum: p2B13
Entry
p2B13             CDS       T00222                                 
Symbol
trbN
Name
(GenBank) TrbN protein of DNA transfer system
Organism
eba  Aromatoleum aromaticum
SSDB
Motif
Pfam: SLT
Other DBs
NCBI-ProteinID: CAI10550
UniProt: Q5NWL4
Position
p2:23815..24414
AA seq 199 aa
MLPFVADLPPLEQERIVCSISSAVKYEVPANIVLAVAEKEGGKPGQWVRNTNGTHDVGPM
QFNTAYLRELERYGITANDVAAAGCYSFDLAAWRLRMHLRNDKGDIWTRAANYHSRTPQF
NAIYRADLMKKAAKWADWLEARFVTLDVIKEGAAPSTPTMQAPAPTAAAATQAAQPTPPR
STRTGAYVPRQITFTSANE
NT seq 600 nt   +upstreamnt  +downstreamnt
gtgctgccgttcgttgcggatctacccccgctggagcaagagcgcatcgtgtgctcgatc
tcgtctgccgtgaagtacgaagtgcccgccaacatcgtcttggcagtcgccgagaaagag
ggcggcaaacccggccagtgggttcgcaacacgaacggcacccatgacgtaggcccgatg
caattcaataccgcgtacctgcgcgaactggagcggtacggcatcacggcgaacgatgta
gcggccgctggctgctactcgttcgacctggccgcctggcggctgcggatgcacctgcgc
aacgacaagggagacatctggacgcgagccgcgaactaccattcgcgcacaccgcaattc
aatgccatctatcgcgccgacctgatgaagaaggcggcgaaatgggcggattggctggaa
gcccggtttgtcaccctcgacgtaatcaaagagggcgcagcgccttcaacaccaacgatg
caggcgcctgcccctacggccgcggcggcgactcaagccgcgcaaccgaccccgccgcga
tccacgcgcacgggtgcgtatgtgccgcgccagatcactttcaccagcgcgaacgaatga

DBGET integrated database retrieval system