KEGG   Aromatoleum aromaticum: p2B18
Entry
p2B18             CDS       T00222                                 
Symbol
traF
Name
(GenBank) TraF protein of DNA transfer system
Organism
eba  Aromatoleum aromaticum
SSDB
Motif
Pfam: Peptidase_S26 GatD_N
Other DBs
NCBI-ProteinID: CAI10573
UniProt: Q5NWJ1
Position
p2:complement(53324..53863)
AA seq 179 aa
MKQLFKKISVGVALAGAAGLTGAALAYSVGARINTTRSIPVGLYWTSPSLAVEKGAYVLF
CPPHLQVFNEARERGYIGAGFCAGGYGYLMKRVLAAKGDDVAVSADGVRVNGVLLPFSAP
KAVDAGGRPLPRFHATRYILGAAELLLMSDMSGTSFDGRYFGPINRSQIVTVVSPVITW
NT seq 540 nt   +upstreamnt  +downstreamnt
atgaagcagctcttcaagaagatcagtgtcggggtggccttggcaggcgcggcggggctc
accggcgccgccctcgcgtattcggtcggcgcacgcatcaataccaccaggagcattccg
gtcggcctgtactggacgagcccaagcctagcggtggagaagggggcttatgtcctcttc
tgcccaccgcacctccaagtcttcaacgaggcacgggaacgcggctacatcggcgccggc
ttctgcgccggcggttacggctatctgatgaagcgcgttttagccgctaaaggcgatgac
gttgccgtatccgccgatggcgtgcgcgtaaacggcgtgctgctgcctttcagtgctccc
aaagctgtcgatgccggcggccgaccgctgccacggttccatgccacccgctacatcctc
ggcgccgccgaactgctgctcatgtccgacatgagtggcacatcgttcgatggccgctac
ttcggccccatcaatcgttcccagatcgtgacagtcgtttccccggtcatcacctggtaa

DBGET integrated database retrieval system