KEGG   Aromatoleum aromaticum: p2B3
Entry
p2B3              CDS       T00222                                 
Symbol
trbC
Name
(GenBank) mating pair formation protein TrbC
  KO
K20528  type IV secretion system protein TrbC
Organism
eba  Aromatoleum aromaticum
Pathway
eba02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:eba00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    p2B3 (trbC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eba02044]
    p2B3 (trbC)
Secretion system [BR:eba02044]
 Type IV secretion system
  Trb secretion system protein
   p2B3 (trbC)
SSDB
Motif
Pfam: TrbC Cation_ATPase_C
Other DBs
NCBI-ProteinID: CAI10539
UniProt: Q5NWM5
Position
p2:13680..14105
AA seq 141 aa
MQVAVPSFRLDRNAVFYLGLLALLAFFLLAPHSAFASEGTGGSLPYESWLTNLRNSVTGP
VAFTLALIGIVVAGGILIFGGELNGFFRTLIFIVLVMALLVGAQNMMSTFFGRGAEIAAV
PEDAIQHAKLAASVVLPKRAG
NT seq 426 nt   +upstreamnt  +downstreamnt
atgcaagtcgcagtgccctcgttccgcctcgatcgtaacgccgtcttctatctcggcctg
ctcgctcttctggccttcttcctgctggcgccgcattcggccttcgcatccgaaggaacg
ggcggttcgctcccgtatgagagctggctgaccaacctgcgcaactccgtcaccggtccg
gtcgcgttcacgctggccctcatcggcatcgtcgttgctggcggcatcctgatcttcggc
ggagagctcaacggtttcttccgcaccttgatcttcatcgtcctggtcatggccctgctg
gtcggcgcgcaaaacatgatgagcaccttcttcggccgtggcgcggaaatcgcggctgtc
cccgaggacgcgatccagcacgccaagctggccgcctcggtggtcctccccaagcgggct
ggataa

DBGET integrated database retrieval system