KEGG   Aromatoleum aromaticum: p2B9
Entry
p2B9              CDS       T00222                                 
Symbol
trbJ
Name
(GenBank) TrbJ protein of DNA transfer system
  KO
K20266  type IV secretion system protein TrbJ
Organism
eba  Aromatoleum aromaticum
Pathway
eba02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:eba00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    p2B9 (trbJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eba02044]
    p2B9 (trbJ)
Secretion system [BR:eba02044]
 Type IV secretion system
  Trb secretion system protein
   p2B9 (trbJ)
SSDB
Motif
Pfam: T4SS DUF4141 Fib_alpha PhaP_Bmeg
Other DBs
NCBI-ProteinID: CAI10546
UniProt: Q5NWL8
Position
p2:20556..21314
AA seq 252 aa
MKMKFLAAKATLVVALSAGPLAAHAGIPVIDAANLSQTIMTAIESVAQTLKQIEQYQTQL
QQYENQIQNTMAPAAYIWDRAQSTINGLMTAVDTLNYYKTQLGSVDGYLGKFQDVAYYRG
SPCFSGAGCSDTERTAMNENRRLASESQKKANDALFRGLDRQQEALKADARTLEQLQSSA
QGASGQMQALGYANQLASQQANQLLQIRGLLIAQQNAVATRMQAEADREAQTIAADEQFR
RGSYRASSGQTW
NT seq 759 nt   +upstreamnt  +downstreamnt
atgaaaatgaaatttttagccgctaaagccaccctggtcgttgctctgtccgcaggcccg
ctcgcggcgcacgccgggattccggtcatcgacgccgcgaacctctcgcaaaccatcatg
acggcgatcgagagcgttgcccagacgctcaagcagatcgagcagtatcaaacgcaacta
cagcagtatgagaaccagattcaaaacacgatggcaccagccgcctacatttgggaccgc
gcgcaatcgaccatcaacggcctgatgaccgccgtcgacacgctgaactactacaagaca
cagcttggcagcgtcgatggctacttgggcaaattccaggacgtggcctattaccggggc
tcgccgtgtttctccggcgccgggtgcagcgacacagagcggacggccatgaacgagaac
cgacgcctggcctccgaatcgcagaagaaggccaacgacgcgcttttccgtggcctcgac
aggcaacaggaagccctcaaggccgacgcccgcacgctggaacaactgcaatccagcgcc
caaggcgccagcggccagatgcaggcgctcggctatgccaaccagctcgccagccagcaa
gccaatcagctcttgcagatacgggggctgttgatcgcccagcagaacgcagttgcgacc
cgcatgcaggccgaggccgaccgggaggcacagactatcgcagcggatgaacaattccgt
cgtggcagttatcgggccagctccgggcagacctggtaa

DBGET integrated database retrieval system