KEGG   Enterobacteriaceae bacterium ENNIH2: C2U52_01420Help
Entry
C2U52_01420       CDS       T05417                                 

Gene name
dfrA
Definition
(GenBank) trimethoprim-resistant dihydrofolate reductase DfrA19
  KO
K19644  dihydrofolate reductase (trimethoprim resistance protein) [EC:1.5.1.3]
Organism
ebc  Enterobacteriaceae bacterium ENNIH2
Pathway
ebc00670  One carbon pool by folate
ebc00790  Folate biosynthesis
ebc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    C2U52_01420 (dfrA)
   00670 One carbon pool by folate
    C2U52_01420 (dfrA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:ebc01504]
    C2U52_01420 (dfrA)
Enzymes [BR:ebc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     C2U52_01420 (dfrA)
Antimicrobial resistance genes [BR:ebc01504]
 Gene variants
  Trimethoprim resistance genes
   Dihydrofolate reductases
    C2U52_01420 (dfrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AUV05032
UniProt: A0A2I8QFQ3
Position
pENT-812c:complement(117784..118353)
Genome map
AA seq 189 aa AA seqDB search
MSHPQLELIVAVDSKLGFGKGGKIPWKCKEDMARFTRISKEIRVCVMGKHTYTDMRDMQL
EKDGAEERIKEKGILPERESFVISSTLKQEDVIGATVVPDLRAVINLYENTDQRIAVIGG
EKLYIQALSSATKLHMTIIPREFDCDRFIPVDPIQNNFHIDSSASETVEATVDETQERIH
FATYVRNNQ
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacccacaacttgagctaatagtcgctgtggattctaagttgggattcgggaaa
ggcggcaagattccatggaaatgcaaagaagacatggcgcgatttacgcggatttctaaa
gagatccgcgtgtgcgttatggggaaacacacgtatactgacatgcgtgacatgcagtta
gaaaaggatggcgccgaggagcgaatcaaggagaaaggaattctccccgaacgcgaatcg
ttcgtgatctcctcgacgttaaaacaagaagatgtcataggcgctactgtcgttcctgat
cttcgtgctgtgatcaacctgtatgagaataccgatcaacgcattgctgtcattggtggg
gagaagttgtacattcaagctctttcatcagcaacgaaactgcacatgaccataattcca
agagagttcgactgtgatcgatttattcctgttgatccgatccagaacaattttcacatt
gattccagtgccagcgagactgtggaggcaaccgttgatgagactcaagagcgcattcac
tttgctacttacgtgcgtaacaatcagtaa

DBGET integrated database retrieval system