KEGG   Enterobacteriaceae bacterium ENNIH2: C2U52_03155Help
Entry
C2U52_03155       CDS       T05417                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
ebc  Enterobacteriaceae bacterium ENNIH2
Brite
KEGG Orthology (KO) [BR:ebc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    C2U52_03155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AUV05353
UniProt: A0A2I8QGF1
Position
292296..292673
Genome map
AA seq 125 aa AA seqDB search
MINSPRVSVQVQSVYIESQSSPDEERYVFAYTITIRNLGRAPVQLLKRYWLITNGNGRET
EVQGEGVVGVQPHIEPGGEYQYTSGAVIETPFGTMEGHYEMIDAQGKAFRIAIPVFRLAV
QTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattcgccccgagtttctgttcaggtgcaaagtgtctatattgaatcgcaatct
tcacccgatgaagaacgctatgttttcgcttacaccatcactattcggaatctggggcga
gcgccggtccagttgcttaaacggtactggcttatcaccaacgggaatggccgtgaaact
gaggttcagggtgaaggtgtggtcggcgttcagccgcatattgaacccggcggagaatat
cagtataccagcggtgcggtaattgaaacgccgtttggtaccatggaaggccattatgaa
atgatcgatgcgcaagggaaggcgttccgcatcgctatcccggtcttccgacttgccgtt
caaacactaatccactga

DBGET integrated database retrieval system