KEGG   Enterobacteriaceae bacterium ENNIH2: C2U52_05880Help
Entry
C2U52_05880       CDS       T05417                                 

Definition
(GenBank) D-lyxose/D-mannose family sugar isomerase
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
ebc  Enterobacteriaceae bacterium ENNIH2
Pathway
ebc00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:ebc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    C2U52_05880
Enzymes [BR:ebc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     C2U52_05880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer Cupin_2 AraC_binding
Motif
Other DBs
NCBI-ProteinID: AUV05849
UniProt: A0A2I8QKP8
Position
821741..822427
Genome map
AA seq 228 aa AA seqDB search
MKRSEINEILGHTRQFFSMHDVHLPPFASFPPTKWHQLDHDSWREVFDLKLGWDVTAFGG
DNFYTQGLTLFTLRNGSPNGTPYAKCYAEKIMHVRDGQVTPMHFHWRKREDIINRGGGNL
IIELWNAGAHEETTYTDVSVVIDGCLQTHSAGSQLRLSPGESICLPPGLYHSFWGESGFG
DVLVGEVSSVNDDEHDNHFLHPVDRFNDILEDEPAQLVLCNEYGLFLS
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgctccgaaatcaatgaaatcctcggccatacccggcaattcttttccatgcac
gacgtccacttgccgcccttcgccagttttcccccaaccaaatggcatcaacttgatcac
gatagctggcgcgaagtcttcgacttaaaactgggttgggatgtcaccgctttcggcggt
gataatttttacacccaggggctcactcttttcaccctgcgcaatggttcgccaaatggc
accccttacgccaaatgctatgcggaaaaaatcatgcacgtgcgcgacgggcaggtcaca
cccatgcattttcactggcgcaaacgcgaagacattattaaccgtggcggcggcaatctg
attatcgagctgtggaacgccggcgcgcatgaagagacgacgtataccgacgtgagcgtg
gttatcgacggttgtctccagacacattcagcgggcagccagttacgcctctcaccaggg
gaaagcatttgcctgccgcccggtctgtaccacagcttttggggcgaatccggtttcggc
gatgtgctggtcggcgaagtgtcgtcggtcaacgatgacgaacatgacaaccacttcctg
cacccggtagatcgctttaacgacattctggaagacgaacccgcgcagctagtgctgtgt
aacgaatatggtctgtttctgagctaa

DBGET integrated database retrieval system