KEGG   Enterobacteriaceae bacterium ENNIH2: C2U52_22505Help
Entry
C2U52_22505       CDS       T05417                                 

Gene name
pdxA
Definition
(GenBank) D-threonate 4-phosphate dehydrogenase
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
ebc  Enterobacteriaceae bacterium ENNIH2
Brite
KEGG Orthology (KO) [BR:ebc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C2U52_22505 (pdxA)
Enzymes [BR:ebc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     C2U52_22505 (pdxA)
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     C2U52_22505 (pdxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA
Motif
Other DBs
NCBI-ProteinID: AUV08830
UniProt: A0A2I8QRD4
Position
4146198..4147184
Genome map
AA seq 328 aa AA seqDB search
MTNIIAVTMGDPAGIGPEIIIKSLVEGELSGAPVVVVGCAHTFNRILALNITPHAELRII
NQVSEAHFAPGVINVLDEPLADPQALEPGKVQAQAGDLAYRCVRRATELAMAGDVKAIAT
APLNKEALHLGGHHYPGHTELLAKLTNINDYAMVLYTDKLKVIHVTTHIALRKFLDTLNQ
DRIKTVIRVADRFLKRVGFANPRIAVAGVNPHAGENGLFGDEEITTVGPAVEAMKAEGIN
VYGPCPPDTVFMQCNEGMYDMVVAMYHDQGHIPLKLLGFYDGVNITAGLPFIRTSADHGT
AFDIAWTGKAKPESMAVSIQLAMQITRE
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
gtgactaacattattgccgtaaccatgggcgatcctgcggggattggtccggagattatt
attaaatcgctggtcgaaggggaactgtccggggcgccggttgtggttgtgggctgtgcc
catacgtttaaccgtattctggcgctgaacatcacgccgcatgcggaactgcgcattatt
aaccaggtcagtgaggcccattttgcccctggcgtgattaacgtactggatgaaccgctg
gcggacccgcaggcattagaacccggtaaagtacaagcccaggcaggcgatctggcctac
cgctgcgtacgtcgtgcgaccgaactggcgatggccggcgacgtgaaggccattgccacc
gcaccgctgaacaaagaagcactgcacttaggtggccaccactatccggggcatactgaa
ctgttggcgaaactgaccaacattaatgactacgcgatggtgctctataccgacaaactc
aaagtgattcacgtcactacgcatatcgcgctgcgtaaattcctcgataccctgaatcag
gatcgtatcaagacggtgattcgtgtggcggacaggttcctcaaacgcgttggctttgca
aatccgcgtatcgcggtggccggggtgaacccgcatgccggagaaaatggcctgtttggc
gatgaagagatcaccaccgtaggtccggcggttgaggccatgaaagccgaaggaatcaat
gtttacggcccgtgcccgccggacacggtgtttatgcagtgcaacgaagggatgtacgac
atggtggtggcgatgtaccacgatcagggacatattccgttaaaattgctgggcttttac
gatggggttaatatcactgctggtttgccgtttatccgtacctctgcggatcatggcacc
gcttttgatatcgcctggaccggaaaagcgaaaccggagagcatggcggtttccatccag
ttagctatgcaaatcacacgagaataa

DBGET integrated database retrieval system