KEGG   Enterobacteriaceae bacterium ENNIH2: C2U52_23700Help
Entry
C2U52_23700       CDS       T05417                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
ebc  Enterobacteriaceae bacterium ENNIH2
Pathway
ebc00620  Pyruvate metabolism
ebc00630  Glyoxylate and dicarboxylate metabolism
ebc01100  Metabolic pathways
ebc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ebc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    C2U52_23700
   00630 Glyoxylate and dicarboxylate metabolism
    C2U52_23700
Enzymes [BR:ebc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     C2U52_23700
    1.2.1.22  lactaldehyde dehydrogenase
     C2U52_23700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA DUF1487
Motif
Other DBs
NCBI-ProteinID: AUV09059
UniProt: A0A2I8QUK2
Position
complement(4409376..4410815)
Genome map
AA seq 479 aa AA seqDB search
MTAPVQHPMYIDGQFVTWQGDAWIDVTNPATEALLSRIPDGTAEDARKAIDAADKAQPAW
EALPAIERAGWLRKIAAGIRARSSEISALIVAEGGKIQQLAEVEVNFTADYIDYMSEWAR
RYEGEILQSDRPGENIFVFKRPLGVTTGILPWNFPFFLIARKLAPALITGNTIVIKPSEF
TPNNAIAFAQIVHEVGLPKGVFNLVLGRGETVGQELAGNPKVAMVSMTGSVVAGEKIMAA
AAKNITKVCLELGGKAPAIVLDDADLELAVKAIVDSRVINTGQVCNCAERVYVQKGIYDR
FVNRLGEAMKAVQFGDPGQRNDIAMGPLINAAALERVESKVARAVSEGARVVLGGKAVEG
KGYFYPPTLLLDVRQEMSIMHEETFGPVLPVVAFDTLEEALAMANDSDYGLTSSVYTQNL
NTAMKAIKGLKFGETYINRENFEAMQGFHAGWRKSGIGGADGRHGLEEYLQTQMVYLQA
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgacagcacccgtacagcaccctatgtatatcgatggtcaatttgttacctggcagggc
gatgcctggattgatgtcaccaacccggcaacggaagcgttgctctcgcgtatcccggac
gggaccgcggaagatgcgcgcaaagcgattgatgccgctgataaagcgcagcctgcgtgg
gaagcattgcctgccatagaacgtgccgggtggttacgcaaaattgccgccggtattcgt
gccagatcgagcgaaatcagtgcgctgattgttgccgaaggcggcaaaatccagcaactg
gcggaggtggaagtcaatttcaccgccgactatatcgattatatgtcggagtgggcgcgt
cgctatgaaggtgaaattctccaaagcgaccgtcccggcgaaaatatctttgtctttaaa
cgtccgctgggcgttaccaccgggatcctgccatggaacttcccgttcttcctgattgcc
cgcaaactggcgccagcgctgattaccggcaacaccattgtcatcaaaccgagtgaattt
acccctaataacgccatcgcttttgcgcagatagtgcatgaagtgggattacccaaaggg
gtctttaacctggtgctgggccggggtgaaaccgtgggccaggagctggcgggcaacccg
aaagtggcgatggtcagcatgacgggtagcgtggtcgcgggtgaaaaaatcatggccgcg
gcggcgaaaaatatcaccaaagtctgcctcgaactgggtggcaaagccccggctatcgtt
cttgacgatgccgatctggaattagcggtgaaagccattgtcgattcccgcgtgatcaac
accggacaggtctgtaactgcgccgaacgtgtttatgtgcagaaaggcatttacgaccgt
tttgttaatcgcctgggcgaggcgatgaaggcggtgcaatttggtgatccgggccagcgc
aatgacatcgcaatggggccgttaattaacgccgccgccctggagcgcgtggaatccaaa
gtcgcccgcgcggtgtcggaaggggcgcgtgtggtgctgggcggtaaagcggtagaaggt
aaaggctatttctacccgccaacgctgctgctggatgtgcgtcaggagatgtccattatg
catgaagagacatttggtccggtgctgccggttgtggcattcgatacgctggaagaggcg
ctggcgatggccaatgacagcgattacggcctgacgtcctctgtctatacgcaaaacctg
aataccgcgatgaaagccattaaagggcttaagttcggcgaaacctacattaaccgtgag
aattttgaagcgatgcagggcttccatgccggctggcgtaagtcggggattggcggcgcg
gatggtcgtcatgggttggaagaatatctgcaaactcagatggtctatctgcaggcataa

DBGET integrated database retrieval system