KEGG   Enterobacteriaceae bacterium ENNIH2: C2U52_26825Help
Entry
C2U52_26825       CDS       T05417                                 

Definition
(GenBank) bifunctional glucose-1-phosphatase/inositol phosphatase
  KO
K01085  glucose-1-phosphatase [EC:3.1.3.10]
Organism
ebc  Enterobacteriaceae bacterium ENNIH2
Pathway
ebc00010  Glycolysis / Gluconeogenesis
ebc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ebc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C2U52_26825
Enzymes [BR:ebc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     C2U52_26825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-ProteinID: AUV09610
UniProt: A0A2I8QTP6
Position
complement(5056321..5057562)
Genome map
AA seq 413 aa AA seqDB search
MKQSLWTLALAALLPFTTTAQADTVPQGYQLEQVLIMSRHNLRAPLANNGSVLEQSTPNK
WPEWEVPGGQLTTKGGVLEVYMGHYMREWLAGQKLVTSGECPAPGTVYAYANSLQRTVAT
AQFFITGAFPGCDIPVHHQEKMGAMDPTFNPVITDGSAEFGEQAIKAMEAQHQHDALGES
YKLLEKIVRYDQSPSCKEKQNCSLATATDTFSASVQQEPGVSGPLKIGNSLVDAFTLQYY
EGFPLDQVAWGEIKTEQQWRLLSKIKNSYQDALFTSPDVARNVAKPLVKYIDKALVTDAA
NTPKVTVLVGHDSNIASLLTALDFAPYQLHDQYERTPIGGKIVFQRWYDSERKRELMKIE
YVYQSSIQLRNAEVLTLKAPAQRVTLSLKGCPIDREGFCPLEKFNAVVSAAAK
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagtctctatggacactcgcgcttgccgcgctgttaccgttcaccacaaccgcg
caggcagacactgttccgcagggttatcagcttgaacaagtgctgattatgagccgccat
aacttacgtgcgccgttggcgaacaacggtagcgtcttggaacaatccacccccaacaag
tggccggaatgggaagttccgggcgggcaattgactaccaaaggtggcgtgcttgaggtc
tatatgggccactacatgcgtgagtggctggccgggcaaaaactggtgacctctggcgaa
tgcccggcaccgggaaccgtttatgcctatgcaaacagcctgcaacgtacggtcgcgacc
gcgcaattctttatcaccggcgcgtttccagggtgcgatattcctgtccaccatcaggaa
aaaatgggggcgatggacccgacatttaacccggttataacggatggatccgccgagttt
ggcgagcaggcgattaaagcgatggaggcgcaacatcagcacgatgcgctgggtgaaagc
tataaattactggaaaaaattgtccgctatgaccagtcaccttcttgtaaagagaagcag
aactgttcactggcgacggccaccgatacctttagcgcgtcggtacaacaggagcctggg
gtttccgggccgctgaaaatcggcaattcactggtagatgctttcacgttgcagtattac
gaaggctttccgttggatcaggtcgcgtggggcgagatcaaaaccgagcagcaatggcgt
ttgctctcgaagatcaaaaatagctatcaggatgccctgtttacgtcacctgatgtggcg
cgcaatgtggcgaaaccactggtgaaatacatcgataaagcgctagtgaccgatgcggca
aacacgccgaaagtgaccgtgctggtaggccatgattccaacatcgcatcgctgctgacc
gcgcttgattttgcgccatatcagcttcatgaccagtatgaacgcacaccgattggcggc
aagatcgtcttccagcgctggtatgacagcgagcgcaaacgcgagttgatgaaaatcgag
tatgtctaccagagcagcatccagttgcgtaatgcggaggtgctgaccctgaaagccccg
gcgcaacgcgtgacgctatcgctgaaaggctgtccgattgaccgtgagggattttgtccg
ctggagaaattcaatgcggttgtgagcgcggcggcgaaataa

DBGET integrated database retrieval system