KEGG   Enterobacteriaceae bacterium ENNIH2: C2U52_27720Help
Entry
C2U52_27720       CDS       T05417                                 

Definition
(GenBank) low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ebc  Enterobacteriaceae bacterium ENNIH2
Pathway
ebc00260  Glycine, serine and threonine metabolism
ebc01100  Metabolic pathways
ebc01110  Biosynthesis of secondary metabolites
ebc01120  Microbial metabolism in diverse environments
ebc01130  Biosynthesis of antibiotics
ebc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ebc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C2U52_27720
Enzymes [BR:ebc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     C2U52_27720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AUV09773
UniProt: A0A2I8QU81
Position
5234740..5235741
Genome map
AA seq 333 aa AA seqDB search
MIDLRSDTVTRPGRAMLEHMLAAPVGDDVYGDDPTVNELQRYAAALGGKEAALFLPTGTQ
ANLVALLSHCERGEEYIVGQAAHNYLYEAGGAAVLGSIQPQPIDAAQDGSLPLDKVAMKI
KPDDIHFARTRLLSLENTHNGKVLPRDYLRQAWELTRQRNLALHVDGARIFNAVVEYGCA
LRDITQYCDSFTICLSKGLGTPVGSLLVGSKDYIRRATRWRKMTGGGMRQAGILAAAGLY
ALEHNVQRLKDDHDNAAWLAAQLREIGADVMRNDTNMLFVRVGEENAAALGAFMRERDVL
INASPIVRLVTHLDVSRDQLADVVSHWQAFLQR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatttacgcagtgataccgtcacccgcccggggcgcgccatgctggaacatatg
ctggcagcgcccgtcggggacgatgtttacggggatgacccgaccgtcaatgaactgcag
cgttacgcggctgcgctgggcggtaaggaagccgcgctgtttctgcctacaggtacccag
gcaaacctggtggctttgctcagccactgcgagcgcggcgaagagtacattgtcggccag
gccgcacataattacctgtacgaagccggtggcgctgccgttctgggcagtatccagccg
cagcctatcgacgccgcacaggacggcagcctgccgctcgataaagtggccatgaaaatc
aagccggacgatatccactttgcccgcacccgcctgttaagcctggaaaacacccacaac
ggtaaagtcctgccgcgcgactacctgcgacaggcgtgggagttaacccgccagcgcaac
cttgcgctgcacgttgatggcgcgcgtattttcaatgccgtggtggaatatggctgtgcg
ttgcgcgacatcacccaatactgcgactcgtttactatttgcctctctaaaggtcttggc
acgcccgtcgggtcactgctggtgggaagcaaggattacatcaggcgcgctacgcgctgg
cgtaaaatgaccggcggcggcatgcgtcaggcgggaatactggcggcagccggtctctat
gcgcttgagcacaatgttcagcggctgaaagacgatcacgataacgcggcctggctggcg
gcacagttgcgtgaaattggcgccgacgtgatgcgcaatgacaccaatatgttgtttgtc
cgcgtaggggaagaaaacgcggcggcgctcggagcctttatgcgtgagcgcgatgtgctg
attaacgcttcgccgattgtgcgcctggtgacccatctggacgtcagccgcgatcagctt
gccgatgttgtttctcactggcaggcgtttttgcagcgttaa

DBGET integrated database retrieval system