KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_0869
Entry
ECBD_0869         CDS       T00939                                 

Definition
(GenBank) (2Fe-2S)-binding domain protein
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
ebd00230  Purine metabolism
ebd01100  Metabolic pathways
ebd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ebd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECBD_0869
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: ACT27937
UniProt: A0A140N3W4
Position
complement(905074..905553)
AA seq 159 aa
MNHSETITIECTINGMPFQLHAAPGTPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAEGKEIRTLEGEAKGGKLSHVQQAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
cacgccgcaccaggcacgccgctctcggaattactccgcgaacaaggactgctaagtgtc
aaacaagggtgctgcgtgggtgaatgtggtgcctgtacggtgttggtcgacggcacagca
atagacagttgcttataccttgccgcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggaaaactttctcatgttcagcaggcttatgcgaaatccggcgca
gtgcagtgcgggttttgtacgcctggcctgattatggctaccacggcaatgctggcgaaa
ccacgcgagaagccattaaccattacggaaattcgtcgcggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttctggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system