KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_1090Help
Entry
ECBD_1090         CDS       T00939                                 

Definition
(GenBank) pseudouridine synthase, RluA family
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Brite
KEGG Orthology (KO) [BR:ebd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ebd03009]
    ECBD_1090
Enzymes [BR:ebd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     ECBD_1090
Ribosome biogenesis [BR:ebd03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ECBD_1090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 S4_2 TruB_N
Motif
Other DBs
NCBI-ProteinID: ACT28156
UniProt: A0A140N6U7
Structure
PDB: 

Position
1137378..1138358
Genome map
AA seq 326 aa AA seqDB search
MAQRVQLTATVSENQLGQRLDQALAEMFPDYSRSRIKEWILDQRVLVNGKVCDKPKEKVL
GGEQVAINAEIEEEARFEPQDIPLDIVYEDEDIIIINKPRDLVVHPGAGNPDGTVLNALL
HYYPPIADVPRAGIVHRLDKDTTGLMVVAKTVPAQTRLVESLQRREITREYEAVAIGHMT
AGGTVDEPISRHPTKRTHMAVHPMGKPAVTHYRIMEHFRVHTRLRLRLETGRTHQIRVHM
AHITHPLVGDPVYGGRPRPPKGASEAFISTLRKFDRQALHATMLRLYHPISGIEMEWHAP
IPQDMVELIEVMRADFEEHKDEVDWL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggcacaacgagtacagctcactgcaacggtgtccgaaaaccaactcggtcaacgctta
gatcaggctttggccgaaatgttcccggattattcacgttcgcgaataaaagaatggatc
ctcgaccagcgagtgctggttaacggcaaagtttgtgataagccgaaagaaaaagtattg
ggtggcgagcaggttgccatcaacgctgagattgaagaagaagcgcgttttgaaccgcag
gatatcccgctggatatcgtctatgaagatgaagacattattatcattaataaaccgcgc
gacctggtggtacatcctggcgcgggtaacccggatggcacggtactgaatgcgttgctt
cattactatccacccattgccgatgtaccgcgtgcgggcatcgtccatcgtctggataaa
gacaccactggcctgatggttgtggcaaaaaccgttccggctcagacgcgtttagtcgaa
tctttgcaacggcgtgaaattactcgtgagtatgaagcggtggcgattggtcatatgacc
gcaggtggcacggtggacgagccaatcagtcgccacccgaccaaacgtacccatatggcg
gtgcatccgatgggcaaaccagcggtgactcactatcgcatcatggaacacttccgtgtg
cacacgcgtctgcggttgcgtctggaaactggacgtacgcaccagatccgcgtgcatatg
gcccatatcactcatccgctggtgggcgatccggtttatggtggccgtccgcgtccgcca
aaaggtgcttcggaagcatttatctccacgctgcgtaagtttgaccgccaggcgctacat
gcaaccatgctgcgtctttatcacccgatctccggcatcgaaatggaatggcatgcgcct
attccacaagatatggtggagctgattgaggtgatgcgcgccgatttcgaagaacataag
gatgaagtggactggttatga

DBGET integrated database retrieval system