KEGG   Escherichia coli BL21-Gold(DE3)pLysS AG: ECBD_1731Help
Entry
ECBD_1731         CDS       T00939                                 

Definition
(GenBank) CDP-diacylglycerol/glycerol-3-phosphate 3-phosphatidyltransferase
  KO
K00995  CDP-diacylglycerol---glycerol-3-phosphate 3-phosphatidyltransferase [EC:2.7.8.5]
Organism
ebd  Escherichia coli BL21-Gold(DE3)pLysS AG
Pathway
ebd00564  Glycerophospholipid metabolism
ebd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ECBD_1731
Enzymes [BR:ebd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.5  CDP-diacylglycerol---glycerol-3-phosphate 1-phosphatidyltransferase
     ECBD_1731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDP-OH_P_transf
Motif
Other DBs
NCBI-ProteinID: ACT28782
UniProt: A0A140N6V4
Position
1844520..1845068
Genome map
AA seq 182 aa AA seqDB search
MQFNIPTLLTLFRVILIPFFVLVFYLPVTWSPFAAALIFCVAAVTDWFDGFLARRWNQST
RFGAFLDPVADKVLVAIAMVLVTEHYHSWWVTLPAATMIAREIIISALREWMAELGKRSS
VAVSWIGKVKTTAQMVALAWLLWRPNIWVEYAGIALFFVAAVLTLWSMLQYLSAARADLL
DQ
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttaatatccctacgttgcttacactgttccgtgtcatccttatcccattcttt
gtattggtcttttatctgcctgtcacctggtcgccgtttgccgccgcgctcattttctgc
gtcgcggcggtgactgactggttcgatggttttctggcacgccgctggaaccagagtacc
cggtttggtgctttccttgaccctgtggcagataaagttctcgtggctatcgccatggtg
ctggtaaccgagcattatcacagctggtgggtgacattaccggcggcaacgatgatcgcc
cgtgaaattattatttctgcgctacgcgaatggatggcggagttgggtaaacgcagtagc
gtggccgtctcctggattgggaaagtgaaaaccactgcccagatggtggcgttggcatgg
ctgctgtggcgtccgaacatttgggttgagtacgccggtattgcacttttctttgtggct
gcggtactgactctgtggtcaatgttgcaatatttgagcgctgcgcgtgcagatttgctt
gatcagtga

DBGET integrated database retrieval system